Dbfetch

ID   AK158062; SV 1; linear; mRNA; HTC; MUS; 3573 BP.
XX
AC   AK158062;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus adult inner ear cDNA, RIKEN full-length enriched library,
DE   clone:F930023N02 product:phosphatidylinositol-4-phosphate 5-kinase, type 1
DE   beta, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3573
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 20879798f7fadb32225d37e8ad5c47af.
DR   Ensembl-Gn; ENSMUSG00000028126; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107233; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107236; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Kirk W. Beisel ( Boys Town National
CC   Research Hospital 555 North 30th Street Omaha,NE 68131 USA ) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=F930023N02
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3573
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="F930023N02"
FT                   /tissue_type="inner ear"
FT                   /db_xref="taxon:10090"
FT   CDS             425..2065
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="phosphatidylinositol-4-phosphate 5-kinase, type 1
FT                   beta (MGD|MGI:107929 GB|NM_008847, evidence: BLASTN, 99%,
FT                   match=2553)"
FT                   /note="putative"
FT                   /db_xref="GOA:P70182"
FT                   /db_xref="InterPro:IPR002498"
FT                   /db_xref="InterPro:IPR016034"
FT                   /db_xref="InterPro:IPR023610"
FT                   /db_xref="InterPro:IPR027483"
FT                   /db_xref="InterPro:IPR027484"
FT                   /db_xref="MGI:MGI:107929"
FT                   /db_xref="UniProtKB/Swiss-Prot:P70182"
FT                   /protein_id="BAE34344.1"
FT                   /translation="MASASSGPAAAGFSSLDAGAPAGTAAASGIKRATVSEGPSASVMP
FT                   VKKIGHRSVDSSGETTYKKTTSSALKGAIQLGITHTVGSLSTKPERDVLMQDFYVVESI
FT                   FFPSEGSNLTPAHHYNDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCSEPLIELSNSGA
FT                   SGSLFYVSSDDEFIIKTVQHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCVQAGGK
FT                   NIRIVVMNNLLPRSVKMHMKYDLKGSTYKRRASQKEREKTLPTFKDLDFLQDIPDGLFL
FT                   DADMYSALCKTLQRDCLVLQSFKIMDYSLLMSIHNMDHAQREPTSNDTQYSADTRRPAP
FT                   QKALYSTAMESIQGEARRGGTVETEDHMGGIPARNNKGERLLLYIGIIDILQSYRFVKK
FT                   LEHSWKALVHDGDTVSVHRPGFYAERFQRFMCNTVFKKIPLKPSPTKKFRSGPSFSRRS
FT                   GPSGNSCTSQLMASGEHRAQVTTKAEVEPDVHLGRPDVLPQTPPLEEISEGSPVPGPSF
FT                   SPVVGQPLQILNLSSTLEKLDVAESEFTH"
FT   regulatory      3554..3559
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      3573
FT                   /note="putative"
XX
SQ   Sequence 3573 BP; 854 A; 865 C; 912 G; 942 T; 0 other;
     ggggtttcct tggccgccca ccctgagccg agcggtggag ttggggataa acaggcagtg        60
     gctggggagg tgagggaggg ggggcattcg cttttggggg cacctcaggt gcctaggttt       120
     tcctttaggt ttgttctatc cgagacgcgg gactcccggg gcccggctca agtgttcctg       180
     tctggtaaga gaaggtagct ttggcggaga gcagttcaag ttgctaggaa ggtgcgagac       240
     tgcagctctc ccccatgccg ggcaagtggt gcggtcctga gcttgtcctg gagcctgaac       300
     aacgcctgtg agaagcccgc cgaacggggg ttctgtgaag agacgtgggg aagattcgat       360
     tccgagaaaa ggaaaagccg gattgaaagg gagcgaagcc gctgaggggg agggggctgc       420
     caagatggcg tccgcctcct cagggccagc ggcggccggg ttttcatccc ttgatgccgg       480
     ggcccctgct ggtaccgcag cagcatctgg aatcaagaga gccacagtat ctgagggacc       540
     ttccgcctct gtcatgcctg ttaaaaaaat aggccatcga agtgttgatt cctctggaga       600
     gactacatac aagaagacaa cttcatcagc cttgaaaggt gccatccagt taggcatcac       660
     tcacactgtg ggcagcctga gcaccaaacc agagcgtgat gtcctcatgc aagacttcta       720
     cgtggtggag agcatctttt tccccagtga aggcagcaac ctgacaccgg ctcaccatta       780
     caatgacttt cgattcaaga cctatgcgcc tgttgccttc cgttacttca gagagctctt       840
     tggcatccgg cctgatgatt acttgtactc cctttgcagt gagccattga ttgaactctc       900
     caattctgga gctagtggtt ccctcttcta tgtgtccagt gatgatgaat tcatcattaa       960
     gaccgtccag cataaagaag cagaatttct gcagaagttg cttccaggat actacatgaa      1020
     tcttaaccaa aaccctcgta ctttgctgcc caaattttat ggattgtact gtgtgcaagc      1080
     aggcggcaag aacatacgaa ttgtggtgat gaacaatctc ttgcctcggt cagtcaaaat      1140
     gcatatgaaa tatgacctga agggttcaac ttacaagcgg cgggcttctc agaaagaacg      1200
     agagaaaact ctccccacct ttaaagacct ggacttccta caagatatcc ctgacggcct      1260
     atttttggat gctgacatgt acagtgctct gtgtaagact ctacagcgtg actgtttggt      1320
     gctgcagagc ttcaagataa tggactacag cctgttgatg tccatccaca acatggacca      1380
     tgcacagagg gagcccacga gcaatgacac acagtactcg gctgacacgc gcagaccagc      1440
     cccacagaag gcgctctatt ccacagctat ggaatccatc cagggcgagg ctcgacgggg      1500
     cggcactgtg gagactgagg accacatggg tggcatccct gcccggaata acaaaggaga      1560
     aaggctcctg ctttatattg gcatcattga tattcttcag tcctacaggt ttgttaagaa      1620
     gttggagcac tcttggaaag cactggtcca tgatggggat acggtgtcag tgcatcgtcc      1680
     aggcttctat gctgagcggt tccagcgttt catgtgcaac acagtgttca agaagattcc      1740
     cttgaagcct tctcctacca aaaagtttcg gtctggcccg tctttctctc ggcgatcagg      1800
     ccccagcggc aactcctgca cctcccagct gatggcctct ggggaacaca gagcacaagt      1860
     gaccaccaag gcggaagtgg agccagatgt acaccttggg cgtcctgatg tcttacctca      1920
     gactccacct ttggaggaaa taagtgaggg ttcacctgtt cctggcccca gtttctcacc      1980
     tgtagttgga caacctttgc aaatactaaa tttgagttca accttggaaa agcttgatgt      2040
     tgcagagtca gagttcaccc actgagcagt gagcctcaga agacctgaaa caagactctg      2100
     ctgtcgcttt gatcccaaga tgtcagccct tgccccagga atgctgaatc gtcttcttgg      2160
     tcatcaacag aggagagaat gtggagctag cagggctctg acactgtctc cccttcctct      2220
     gggcagtagt gcctttgaca gttgaggaca gcatcgtccc caccactcca gaagtgggtg      2280
     gcgtgaattt tccactgcct gccatggctt ctatagctga atatttttca aacccccatt      2340
     ctttgtgctg acatggggtt gctggactgg tggtttcctc ctgtttacct ttctcctgga      2400
     gctggactct tcatttcctc aggacggact ggctggacat tgttcctgcc ttggctctcc      2460
     cgctggtctt tggagactcc caatgatttg tataaaggtg tttgggggaa agtaaggatc      2520
     atccttactc ccaaccttct tttccttaaa aaagaaaaaa aaaaaaaaaa aacacaaaga      2580
     gcacacaatg taaatttgag ccagtctcag ataaaagttc tctaagtgtt gtagaagagc      2640
     cctagtgttt gtgaagcaga aaggctgggg ctgccccacc agcagctgct ctctgactcc      2700
     ctcacttagg gttgagggaa tagagagggc ctggcccttt tttaagacaa aggggcagcc      2760
     atgttaggag agtggacctt agcaggaccc tactcactgc caggtcttcg gttattacta      2820
     ttctgcaatt tggaatgtat cctcatagtt ttttctagat ataaagaatt atcaaatgat      2880
     tttagaccat tctccaaagg agatttcttt gttcttccta tattttccaa cagtattctg      2940
     ctctttgtgg agctacggtg gagggagatg tttgtgtctg tttaacaggc agtctgtatc      3000
     tatgaggcta gagaatattt tcttaaactc ctagggagcc acagacttcc ctctgtacgg      3060
     ttgtcgccat gtcacctggc ctgcccttac tctgcagaga agctggaaat ggggccacgg      3120
     agccctctcc ttcctctcag ttgtggccca tctggtcctg gctggtgggg cagtgcatgg      3180
     tgtttcaggc tggctgttga aatcccacat tagttccttc cctgtcccgt cccaccttga      3240
     tagcaggtta gccaaccccc acgtaactgt ctatattaga cacccccagc caccttctgg      3300
     ctgcctgtct ttgctgccat gttctttttt acaagaagga aacaaacaat ttcttgctat      3360
     ttttttttca taatttacta tttatgatgt atttaagtgt tttattcagg acagggttct      3420
     gtaaggggtg ggagggagta tttgagggag ggctgggact tagggaaagg acatgggatt      3480
     caacattttt atggagtgtt actatttgcc tctactttgt attgttgaaa aatgacagat      3540
     gcaatataaa agtaataaat atctggtttt aat                                   3573
//