spacer

EBI Dbfetch

ID   AK157558; SV 1; linear; mRNA; HTC; MUS; 2263 BP.
XX
AC   AK157558;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus activated spleen cDNA, RIKEN full-length enriched library,
DE   clone:F830223F09 product:inositol polyphosphate-5-phosphatase A, full
DE   insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2263
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 68bc2bac803241ce165bbfe4881f854a.
DR   Ensembl-Gn; ENSMUSG00000025477; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000097975; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Dr. John Todd (Dept. of Medical Genetics
CC   Wellcome Trust Centre for Molecular Mechanisms in Disease Wellcome
CC   Trust/MRC building Addenbrookes Hospital Cambridge) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=F830223F09
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2263
FT                   /organism="Mus musculus"
FT                   /strain="NOD"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="F830223F09"
FT                   /tissue_type="activated spleen"
FT                   /db_xref="taxon:10090"
FT   CDS             121..1383
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="inositol polyphosphate-5-phosphatase A
FT                   (MGD|MGI:2686961 GB|BC056341, evidence: BLASTN, 99%,
FT                   match=2043)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q3TZT4"
FT                   /db_xref="InterPro:IPR000300"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="MGI:MGI:2686961"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TZT4"
FT                   /protein_id="BAE34123.1"
FT                   /translation="MQGLWGLPDQLGVTFHVLLLCLSRKTWPGESMLPENLQKNWLREF
FT                   YQVLHTHKPHFMALHCQEFGGKNYEASMSHVDKFVKELLSSDAMKEYNRARVYLDENYK
FT                   SQEHFTALGSFYFLHESLKNIYQFDFKAKKYKKVTGKEIYSDTLESTPMLEKEKFPQDY
FT                   FPECKWSRKGFIRTRWCIADCAFDLVNIHLFHDASNLVAWETSPSVYSGVRHKALGYVL
FT                   DRIIDQRFEKVSYFVFGDFNFRLDSKSVVETLCTKATMQTVRAADTNEVVKLIFRESDN
FT                   DRKVVLQLEKKLFDYFNQDVFRDNNGTALLEFDKELSVFKDRLYELDISFPPSYPYSED
FT                   SSQGEQYMNTRCPAWCDRILMSLSAKELVLKSESEEKVATYDHIGPNVCMGDHKPVFLA
FT                   FRIAPGAGKPHAHVHKCCVVQ"
FT   polyA_signal    2236..2241
FT                   /note="putative"
FT   polyA_site      2263
FT                   /note="putative"
XX
SQ   Sequence 2263 BP; 578 A; 571 C; 549 G; 565 T; 0 other;
     gaccctgtca ctgtccaggt gggaggagag ggcacaaaac agtaccctgc tgacagactc        60
     aaggttgtct gagaccctta gggggtcaga tgggtctcat ttcccaactt gcctcatttg       120
     atgcaggggc tttggggtct cccagaccag ctcggtgtta catttcatgt gcttctgctg       180
     tgtcttagca gaaagacatg gcctggagag agcatgctgc cagaaaacct gcagaagaac       240
     tggcttcggg aattttacca ggtcctgcac acacacaagc ctcacttcat ggccttgcac       300
     tgccaagaat ttggagggaa aaactacgag gcctccatgt cccatgtgga caaatttgtc       360
     aaagaactac tatccagtga cgcaatgaaa gaatacaaca gggcgcgtgt ctacctggat       420
     gaaaactaca agtcacagga acacttcacg gcactaggaa gcttttattt tcttcacgaa       480
     tccttaaaaa acatctacca gtttgacttt aaagctaaga agtataaaaa agtcactggc       540
     aaggagatct attcggacac tttggagagc acacccatgc tggagaagga gaagttccca       600
     caggactact ttcctgagtg caaatggtca agaaaaggct tcatcaggac gcggtggtgc       660
     attgctgact gtgccttcga cttggtgaac attcatcttt ttcatgatgc atccaactta       720
     gtggcctggg agacaagccc ctcagtgtac tccggtgtca ggcacaaggc tctgggctat       780
     gtgctggaca gaatcatcga ccagcgattt gagaaagttt cctactttgt cttcggtgat       840
     ttcaacttcc gcctggattc caagtctgtc gtagagacac tctgcacaaa ggccacaatg       900
     cagacagtcc gcgctgccga taccaatgaa gttgtaaagt tgatatttcg ggagtcagac       960
     aatgaccgga aggtcgtgct ccagttggaa aagaagctct tcgactactt caaccaggat      1020
     gtcttccggg acaacaacgg cactgcgctc ttggaatttg acaaggagtt gtctgtcttt      1080
     aaggacagac tgtatgaact ggacatctca ttccccccca gctacccgta cagtgaggac      1140
     tccagccagg gagaacagta catgaacacg agatgccctg cttggtgtga tcgcatcctc      1200
     atgtccctgt ctgccaagga gctggttctt aagtcagaga gcgaggagaa ggttgccacc      1260
     tacgaccaca tcgggcctaa tgtctgcatg ggagaccaca agccggtgtt cctggccttc      1320
     cgaatcgcac ctggggcagg taaacctcac gcccatgtac acaagtgttg tgtcgtgcag      1380
     tgacgtggtg ggaagaggtg ccagcgccgc gagaggatcc tcgagaggcc tccctgtagc      1440
     agtgtatcca actcatcctc ctaacagctg catcggaacc gcccaagcct cacctgctag      1500
     acggccggcc ccacacttcg cttcagcctc cggacctccg gaaagcctca catacctcac      1560
     tgtcgtgtct gtcacgtgac attgtagaca tattgggtgt aatcaagcca cagtcctatt      1620
     gccaaaactc taacagacag cagagcgcct gtattttaga cttcacagtt ttccattttt      1680
     aacaattgtc tgtggaggaa gcttctccat ttagagcccc aagtgtccag cgtccctctc      1740
     tgccaggagg agtgtgccgg gcactagccc aggcagccag gctgccacgt gtgcccaagc      1800
     ccgaggcctg aggtctgact ctactgccat gttacgtggc gtgagaatca cactgcagct      1860
     gctttccatt tttatatata taaatacata taaatatata ctttttaaaa ataatttata      1920
     aatcttacca aaacttatgc tgaatatact ttccagtatg agtgcacgag tgtcctgagc      1980
     aggcagaacc gcagtctaga tgaatggcga ctccatcagc agtcggcacc tgttcctgag      2040
     acaaggccta gccagtgccc agggcgaggg gccctgtgat ctgcctgtac tagcagtttg      2100
     tcactcttct gccttttctg tgtaatatta agaactgaat gtgaagttta tagctagcct      2160
     gggtgtacct tttaagaatt ttgtaaactg ttttgtctgt cttttgttac cgttttatgg      2220
     tgccaagtag cctacattaa aaccataatc ttgtgggaga atg                        2263
//


spacer
spacer