Dbfetch

ID   AK156723; SV 1; linear; mRNA; HTC; MUS; 2016 BP.
XX
AC   AK156723;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus activated spleen cDNA, RIKEN full-length enriched library,
DE   clone:F830043P11 product:cysteine rich protein 61, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2016
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 0feb033a84c1b25f6221a500a1351b54.
DR   Ensembl-Gn; ENSMUSG00000028195; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027961; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0027920; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0027886; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027932; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027662; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028375; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027115; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0027637; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0027777; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0027744; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0027888; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027777; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028434; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026838; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027195; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000029846; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0064182; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0064211; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0064153; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0064133; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0063822; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0064627; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0064138; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0063782; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0063896; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0063854; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0064039; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0063855; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0064847; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0063674; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0063080; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Dr. John Todd (Dept. of Medical Genetics
CC   Wellcome Trust Centre for Molecular Mechanisms in Disease Wellcome
CC   Trust/MRC building Addenbrookes Hospital Cambridge) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=F830043P11
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2016
FT                   /organism="Mus musculus"
FT                   /strain="NOD"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="F830043P11"
FT                   /tissue_type="activated spleen"
FT                   /db_xref="taxon:10090"
FT   CDS             189..1328
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="cysteine rich protein 61 (MGD|MGI:88613
FT                   GB|NM_010516, evidence: BLASTN, 99%, match=2012)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q3TX21"
FT                   /db_xref="InterPro:IPR000867"
FT                   /db_xref="InterPro:IPR000884"
FT                   /db_xref="InterPro:IPR001007"
FT                   /db_xref="InterPro:IPR006207"
FT                   /db_xref="InterPro:IPR006208"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="InterPro:IPR012395"
FT                   /db_xref="InterPro:IPR017891"
FT                   /db_xref="InterPro:IPR036383"
FT                   /db_xref="MGI:MGI:88613"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TX21"
FT                   /protein_id="BAE33819.1"
FT                   /translation="MSSSTFRTLAVAVTLLHLTRLALSTCPAACHCPLEAPKCAPGVGL
FT                   VRDGCGCCKVCAKQLNEDCSKTQPCDHTKGLECNFGASSTALKGICRAQSEGRPCEYNS
FT                   RIYQNGESFQPNCKHQCTCIDGAVGCIPLCPQELSLPNLGCPNPRLVKVSGQCCEEWVC
FT                   DEDSIKDSLDDQDDLLGLDASEVELTRNNELIAIGKGSSLKRLPVFGTEPRVLFNPLHA
FT                   HGQKCIVQTTSWSQCSKSCGTGISTRVTNDNPECRLVKETRICEVRPCGQPVYSSLKKG
FT                   KKCSKTKKSPEPVRFTYAGCSSVKKYRPKYCGSCVDGRCCTPLQTRTVKMRFRCEDGEM
FT                   FSKNVMMIQSCKCNYNCPHPNEASFRLYSLFNDIHKFRD"
FT   regulatory      1998..2003
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      2016
FT                   /note="putative"
XX
SQ   Sequence 2016 BP; 495 A; 536 C; 530 G; 455 T; 0 other;
     ggcggtgagc gagagcgccc cagagaagcg cctgcaatct ctgcgcctcc tccgccagca        60
     cctcgagaga aggacacccg ccgcctcggc cctcgcctca ccgcactccg ggcgcatttg       120
     atcccgctgc tcgccggctt gttggttctg tgtcgccgcg ctcgccccgg ttcctcctgc       180
     gcgccacaat gagctccagc accttcagga cgctcgctgt cgccgtcacc cttctccact       240
     tgaccagact ggcgctctcc acctgccccg ccgcctgcca ctgccctctg gaggcaccca       300
     agtgcgcccc gggagtcggg ttggtccggg acggctgcgg ctgctgtaag gtctgcgcta       360
     aacaactcaa cgaggactgc agcaaaactc agccctgcga ccacaccaag gggttggaat       420
     gcaatttcgg cgccagctcc accgctctga aagggatctg cagagctcag tcagaaggca       480
     gaccctgtga atataactcc agaatctacc aaaacgggga aagcttccag cccaactgta       540
     aacaccagtg cacatgtatt gatggcgccg tgggctgcat tcctctgtgt ccccaagaac       600
     tgtctctccc caatctgggc tgtcccaacc cccggctggt gaaagtcagc gggcagtgct       660
     gtgaagagtg ggtttgtgat gaagacagca ttaaggactc cctggacgac caggatgacc       720
     tcctcggact cgatgcctcg gaggtggagt taacgagaaa caatgagtta atcgcaattg       780
     gaaaaggcag ctcactgaag aggcttcctg tctttggcac cgaaccgcga gttcttttca       840
     accctctgca cgcccatggc cagaaatgca tcgttcagac cacgtcttgg tcccagtgct       900
     ccaagagctg cggaactggc atctccacac gagttaccaa tgacaaccca gagtgccgcc       960
     tggtgaaaga gacccggatc tgtgaagtgc gtccttgtgg acaaccagtg tacagcagcc      1020
     taaaaaaggg caagaaatgc agcaagacca agaaatcccc agaaccagtc agatttactt      1080
     atgcaggatg ctccagtgtc aagaaatacc ggcccaaata ctgcggctcc tgcgtagatg      1140
     gccggtgctg cacacctctg cagaccagaa ctgtgaagat gcggttccga tgcgaagatg      1200
     gagagatgtt ttccaagaat gtcatgatga tccagtcctg caaatgtaac tacaactgcc      1260
     cgcatcccaa cgaggcatcg ttccgactgt acagcctatt caatgacatc cacaagttca      1320
     gggactaagt gcctccaggg ttcctagtgt gggctggaca gaggagaagc gcaagcatca      1380
     tggagacgtg ggtgggcgga ggatgaatgg tgccttgctc attcttgagt agcattaggg      1440
     tatttcaaaa ctgccaaggg gctgatgtgg acggacagca gcgcagccgc agttggagaa      1500
     tgccaagggg ctgatgtgga cggacagcag cgcagccgca gttggagaag acttcgcttc      1560
     atagtactgg agcgggcatt attgctccat attggagcat gtttacggat gacgttctgt      1620
     tttctgtttg taaattattt gctaagtgta tttttttgct ccagaccccc cccccccttt      1680
     cttggttcta caattgtaat agagacaaaa taagattagt tgggccaagt gaaagccctg      1740
     cttgtccttt gacagaagta aatgaaagcg cctctcattc cttcccgagc ggagggggga      1800
     cactctgtga gtgtccttgg ggcagctacc tgcactctaa aactgcaaac agaaaccagg      1860
     tgttttaaga ttgaatgttt ttttatttat caaagtgtag cttttgggga gggaggggaa      1920
     atgtaatact ggaataattt gtaaatgatt ttaattttat atcagtgaag agaatttatt      1980
     tataaaatta atcatttaat aaagaaatat ttacct                                2016
//