spacer

EBI Dbfetch

ID   AK156494; SV 1; linear; mRNA; HTC; MUS; 3447 BP.
XX
AC   AK156494;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus activated spleen cDNA, RIKEN full-length enriched library,
DE   clone:F830027D23 product:solute carrier family 9 (sodium/hydrogen
DE   exchanger), isoform 9, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3447
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 46d5cd1a96b9ffd3796a824c129c0aa2.
DR   Ensembl-Gn; ENSMUSG00000031129; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033463; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Dr. John Todd (Dept. of Medical Genetics
CC   Wellcome Trust Centre for Molecular Mechanisms in Disease Wellcome
CC   Trust/MRC building Addenbrookes Hospital Cambridge) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=F830027D23
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3447
FT                   /organism="Mus musculus"
FT                   /strain="NOD"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="F830027D23"
FT                   /tissue_type="activated spleen"
FT                   /db_xref="taxon:10090"
FT   CDS             132..2066
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="solute carrier family 9 (sodium/hydrogen exchanger),
FT                   isoform 9 (MGD|MGI:2679732 GB|NM_177909, evidence: BLASTN,
FT                   99%, match=2448)"
FT                   /db_xref="GOA:Q8BZ00"
FT                   /db_xref="InterPro:IPR002090"
FT                   /db_xref="InterPro:IPR004709"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018416"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="MGI:MGI:2679732"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8BZ00"
FT                   /protein_id="BAE33731.1"
FT                   /translation="MAGQLRFTSGKDEDHFQHQGAVELLAFNFLLILTILTIWLFKNHR
FT                   FRFLHETGGAMVYGLIMGLILRYATAPTDIDSGTVYNCGNLFFSPSTLLVNITDQVYEY
FT                   KYQREINQHNISPHQGNAILEKMTFDPEIFFNVLLPPIIFHAGYSLKKRHFFQNLGSIL
FT                   TYAFLGTAISCVVIGLIMYGFVKAMVHAGQLKSGDFHFTDCLFFGSLMSATDPVTVLAI
FT                   FHELHVDPDLYTLLFGESVLNDAVAIVLTYSISIYSPKENPNAFDTAAFFQSVGNFLGI
FT                   FAGSFAMGSAYAVVTALLTKFTKLREFPMLETGLFFLLSWSAFLSAEAAGLTGIVAVLF
FT                   CGVTQAHYTYNNLSSDSKLRTKQLFEFMNFLAENVIFCYMGLALFTFQNHIFNALFILG
FT                   AFLAIFVARACNIYPLSFLLNLGRKQKIPWNFQHMMMFSGLRGAIAFALAIRNTESQPK
FT                   QMMFTTTLLLVFFTVWVFGGGTTPMLTWLQIRVGVDLDESLKEEPSSQQEANKLDKNMT
FT                   KTESAQLFRMWYGFDHKYLKPILTHSGPPLTTTLPAWCGPVSRLLTSPQAYGEQLKEDD
FT                   VECIVNQDELAMNYQEQSPSPSSPTTKLALDQKSSGQTPGKENIYEGDLGLGGYDLKLE
FT                   QTRGQPQMD"
FT   polyA_signal    3428..3433
FT                   /note="putative"
FT   polyA_site      3447
FT                   /note="putative"
XX
SQ   Sequence 3447 BP; 880 A; 849 C; 798 G; 920 T; 0 other;
     ggaagtagca acaaagtagc agcgtttatt ctgaaattct gtgggcgcca gtctatccta        60
     ggcaaccctc atctaagggc tcatcccttg tccagggatt tctctgagca tcacagtcgg       120
     tcgagtggag aatggctggg cagcttcggt ttacgtcagg gaaggatgaa gatcattttc       180
     aacaccaggg agcagtggag ctactcgcgt ttaatttttt gctcatcctt accattttaa       240
     caatctggtt atttaaaaat caccgattcc gcttcttgca tgagactgga ggggcgatgg       300
     tgtatggcct cataatggga ctaattttgc gatatgccac agcgccgact gatattgata       360
     gtggaactgt ctacaactgt gggaacttgt tcttcagccc atcaactcta ctagtcaaca       420
     tcaccgacca agtttatgag tataagtacc agagagagat caaccagcac aatatcagcc       480
     cccaccaagg caacgccata ctggagaaga tgacgtttga cccagaaatc ttcttcaacg       540
     ttttgctgcc tcccatcata tttcatgcag gatacagtct gaagaagaga cacttttttc       600
     aaaacttggg atccatttta acgtatgcct tcttgggaac agccatctcc tgtgtggtca       660
     tagggttaat tatgtacggc tttgtgaaag ccatggtgca tgctggccag ctgaagagcg       720
     gagacttcca cttcactgac tgtttatttt ttggttcact gatgtctgct acagatccag       780
     tgacagtgct ggccattttc catgaactcc acgtggaccc agacctgtac acactgctgt       840
     ttggagagag tgtactgaat gatgcggtgg ccatagtcct cacatactct atatccatct       900
     atagtcccaa ggagaatccc aacgcgtttg acacggcagc gttcttccaa tccgtgggca       960
     atttcctagg gatctttgcc ggctcctttg caatgggctc cgcatatgca gttgttaccg      1020
     cactgttgac caaatttacc aagctccgtg agttcccgat gctggagaca ggcctgtttt      1080
     tcctcctttc ttggagtgcc ttcctgtctg cagaggccgc cggcttaaca ggcatagttg      1140
     ctgttctctt ctgtggagtc acacaggcac attacaccta caacaatctg tcatcggatt      1200
     ccaaactgag gaccaaacag ctgtttgaat ttatgaactt cctggctgaa aacgtcatct      1260
     tctgctacat gggcctggct ctgttcacct tccagaatca cattttcaat gctcttttta      1320
     tactcggagc ctttctagca atttttgttg ccagagcctg caacatttac cccctctcct      1380
     tcctcctgaa tctgggcaga aagcagaaga ttccctggaa cttccagcac atgatgatgt      1440
     tttcaggttt gcgaggtgcc attgccttcg ccctggccat ccgcaacacg gaatctcagc      1500
     ccaaacagat gatgttcacc accacactgc tccttgtgtt cttcactgtc tgggtgtttg      1560
     gaggaggaac gacccccatg ctgacgtggc ttcagatcag agttggtgtg gacctggatg      1620
     aaagtctgaa ggaagagccc tcctcacagc aggaagcaaa taagttggac aaaaacatga      1680
     cgaagacaga gagtgcacag ctcttcagaa tgtggtatgg atttgaccac aaatacctga      1740
     aacccatcct aacacactca ggccctccac tgaccaccac cttgccagcg tggtgtggcc      1800
     cagtctccag gctgctcacc agtccgcagg cctatgggga acaactgaaa gaggatgacg      1860
     tggaatgtat cgtcaaccaa gatgaactgg ccatgaatta ccaggagcag agcccttcac      1920
     ccagcagtcc caccaccaag ctagctctgg accagaagtc ttcaggccag actccaggca      1980
     aggagaatat ctacgaggga gatctcggcc tgggaggcta tgatctcaaa ctggagcaga      2040
     ctcggggtca accccagatg gactaattgg tatgatgagt gcagacttaa tcacatgtaa      2100
     cacaagacca ctgaggaatg ccaacagcca aggaggtggt gcagagagag acagaaagag      2160
     tattaagaac ataaattgga cagaatcaaa ccttatcaca tgtatcctcc cgtgccttca      2220
     gaaatgagaa ttcattatct tccctctgta ttatgcaacc tcatttaatt atctgacagc      2280
     catttttact gctgaattag gggccaggag agtcaggtcc tagctgccat tgggatgaac      2340
     catatgtgct gtgtctgcag ggggcccctt ctgttcctca gacagctctc caggcccttc      2400
     atgtggattt tggattcgat tccattaatt atggaacatt aataacatga agaagaagaa      2460
     gaaaaaaaac tcctgagcat aaatgataag ccttatctct caacttgact ccacttgttc      2520
     ggaccatagg gctaaatgca gaaaccagtg tgtgttcagt acccactctt gatggctttg      2580
     gagaattcac atgaattggg ggccttgttg tccttgctgg cgctctctcc atgcagttct      2640
     tcccactccc tccaaggagc tgcttgcccc accgggtgtg tgcatgttaa gtgtaggctc      2700
     ttgccagctt aaggggactc tctccaggga aagctggtct ctttcccaca ttctgtgttt      2760
     tattcaaatg gtgagcctct cttccttgtg tgcactggga caacttcctg ataggttccc      2820
     tctgcatgct gggaagtcat gttttgcagc atgacccttc cacatggggt tggaggattg      2880
     tgcaggagcc ctcacctttt ccaccaatat ctgtaactga ttggcaatag aggggcaaaa      2940
     agaacagagc taatgacatt taggccacac tgaggcacca aggacaagca ccagtcagga      3000
     tctcccccat tcccagagtg gccagtggct gcattgaaga gaccaacatc atagctttta      3060
     attcagctgc atgactcgtg cctttgaagc cataagatac ctcaagccta gcttctcttg      3120
     atgtgcagat gttctattag gctccaaaga gcaggcttca gacttgggag cccaagatgt      3180
     gatgggtttc ttttgaggga gatgaagaac gatttctttc tcaggcccaa aggctaaaac      3240
     taatgcatgc ttcactgagt gcttcttagg ccttaggcct gtgagatcag gtaccctgcc      3300
     tgcgtgtctg tttttcttgc ttccaaatag tagaaactgg gagaaacttt tatattcaac      3360
     tgagtaaaat cttgtcatgt caggtaaata tggcaaggag agaggttttc taatgtgaca      3420
     tcatcctaat aaactttgtt atggagc                                          3447
//


spacer
spacer