Dbfetch

ID   AK156371; SV 1; linear; mRNA; HTC; MUS; 2217 BP.
XX
AC   AK156371;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus activated spleen cDNA, RIKEN full-length enriched library,
DE   clone:F830019A17 product:estrogen related receptor, alpha, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2217
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 14cd412df61781f34d4eb8f5dda91ccd.
DR   Ensembl-Gn; ENSMUSG00000024955; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024770; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0024736; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0024709; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024736; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024504; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023976; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_DBA2J_G0024603; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0024569; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0024689; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024598; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025230; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023722; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024038; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000025906; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0050857; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0050837; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0050793; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0050786; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0050528; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_CASTEiJ_T0050663; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_DBA2J_T0050561; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0050527; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0050685; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0050523; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0051394; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0050256; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0049817; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Dr. John Todd (Dept. of Medical Genetics
CC   Wellcome Trust Centre for Molecular Mechanisms in Disease Wellcome
CC   Trust/MRC building Addenbrookes Hospital Cambridge) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=F830019A17
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2217
FT                   /organism="Mus musculus"
FT                   /strain="NOD"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="F830019A17"
FT                   /tissue_type="activated spleen"
FT                   /db_xref="taxon:10090"
FT   CDS             176..1444
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="estrogen related receptor, alpha (MGD|MGI:1346831
FT                   GB|BC039774, evidence: BLASTN, 100%, match=2215)"
FT                   /note="putative"
FT                   /db_xref="GOA:O08580"
FT                   /db_xref="InterPro:IPR000536"
FT                   /db_xref="InterPro:IPR001628"
FT                   /db_xref="InterPro:IPR001723"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="InterPro:IPR024178"
FT                   /db_xref="InterPro:IPR027289"
FT                   /db_xref="MGI:MGI:1346831"
FT                   /db_xref="UniProtKB/Swiss-Prot:O08580"
FT                   /protein_id="BAE33690.1"
FT                   /translation="MSSQVVGIEPLYIKAEPASPDSPKGSSETETEPPVTLASGPAPAR
FT                   CLPGHKEEEDGEGAGSGEQGSGKLVLSSLPKRLCLVCGDVASGYHYGVASCEACKAFFK
FT                   RTIQGSIEYSCPASNECEITKRRRKACQACRFTKCLRVGMLKEGVRLDRVRGGRQKYKR
FT                   RPEVDPLPFPGPFPAGPLAVAGGPRKTAPVNALVSHLLVVEPEKLYAMPDPASPDGHLP
FT                   AVATLCDLFDREIVVTISWAKSIPGFSSLSLSDQMSVLQSVWMEVLVLGVAQRSLPLQD
FT                   ELAFAEDLVLDEEGARAAGLGDLGAALLQLVRRLQALRLEREEYVLLKALALANSDSVH
FT                   IEDAEAVEQLREALHEALLEYEAGRAGPGGGAERRRAGRLLLTLPLLRQTAGKVLAHFY
FT                   GVKLEGKVPMHKLFLEMLEAMMD"
XX
SQ   Sequence 2217 BP; 420 A; 635 C; 737 G; 425 T; 0 other;
     gcgcgatgtc cttttgtgtc ctacaagcag ccagcggcgc cgccgagtga ggggggacgc        60
     agcgcggcgg ggcggtgcgg ccggaggagg cggcccccgc tcaccccggc gctccgggcc       120
     gctcggcccc catgcctgcc cgccagccct gccggagccc aaggtgacca gcaccatgtc       180
     cagccaggtg gtgggcatcg agcctctcta catcaaggca gagccagcca gtcctgacag       240
     tccaaagggt tcctcagaga ctgagactga acccccggtg accctggcct ctggtccagc       300
     tccagcccgc tgccttccag ggcacaagga ggaggaggat ggggaggggg cagggtctgg       360
     tgagcagggc agtgggaagc tagtgctcag ctctctaccc aaacgcctct gcctggtctg       420
     tggggatgtg gcctctggct accactacgg tgtggcatcc tgtgaggcct gcaaagcctt       480
     cttcaagagg accatccagg ggagcatcga gtacagctgt ccggcctcca atgagtgtga       540
     gatcaccaag cggagacgca aggcctgtca ggcctgccgc ttcaccaagt gcctgcgggt       600
     gggcatgctc aaggagggtg tgcgtctgga ccgtgtccgc ggcggacggc agaagtacaa       660
     acggcggcca gaggtggacc ctttgccttt cccgggcccc ttccctgctg gacctctggc       720
     agtagctgga ggacccagga agacagcccc agtgaacgct ctggtgtcgc atctgctggt       780
     ggttgaacct gagaagctgt acgccatgcc tgacccagca agccccgatg gacacctccc       840
     cgctgtggcc actctctgtg acctttttga tcgagagata gtggtcacca tcagctgggc       900
     caagagcatc ccaggcttct cctcactgtc actgtctgac cagatgtcag tactgcagag       960
     tgtgtggatg gaagtgctgg tgctgggtgt ggcccagcgc tcactgccac tgcaggatga      1020
     gctggccttt gctgaggacc tggtcctaga tgaagagggg gcacgggcag ctggcctggg      1080
     ggatctgggg gcagccctgc tgcagctggt tcggcgactg caagctcttc ggctggagcg      1140
     ggaggagtac gtcctgctga aagctctggc ccttgccaat tctgactctg tgcacattga      1200
     agatgctgag gctgtggagc agctgcgcga agccctgcat gaggccctgc tggagtatga      1260
     agctggccgg gctggccctg gagggggtgc tgagcggagg cgtgcaggca ggctgctgct      1320
     tacgctgcca ctcctccgcc agacagcagg caaagtcctg gcccatttct atggggtgaa      1380
     gctggagggc aaggtgccca tgcacaagct gtttttggaa atgcttgagg ccatgatgga      1440
     ctgaggcaag gggtgggaca gggtggggtg gctggcagga tctgcccagc atagggtgtt      1500
     agccccaaag gggcaaagct ggagtctggg cagtgccata gcctgctggc agggccaggg      1560
     caatgccatc cgcccctggg agaaggcttc atgcccttcc ctccccactt tgtgtgtgtg      1620
     ggggattgtc agaagccagg aaagtgaatg cccaggtgtg ggcacagtgc tgccccttgc      1680
     aagccataac gtgcccccca agagtgttgg gggcctcgcg gaagccatag ggggctgcag      1740
     gggatgtgca ggaggcagac actgatctca gggagggaag ggatggaggc cgccggctcc      1800
     cactgggtga tgcttttgct gctgcttaat ccgatctcct ctccggagca gaggggggct      1860
     tggaaagcaa aggccccgtc ccttcgctcc tctcctcatc cgcattgggc attattgccc      1920
     ccccttgaag caataactcc aagcaggctc cagcccctgg accccagggg tggccagggc      1980
     cccctatcag ctcccacctc aaggggtggg ggacagcact gcctctatgc cctgcagagc      2040
     aataacacta tatttatttt tgggtttggc cagggaggcg cagggccatg gggcaagcca      2100
     gggcccagag cccttggctg tacagagact ctattttaat gtatatttgc tgcaaagaga      2160
     aaccgctttt ggttttgaac ctttaatgag aaaaaaaata tactatggag ctcaagc         2217
//