Dbfetch

ID   AK155952; SV 1; linear; mRNA; HTC; MUS; 2603 BP.
XX
AC   AK155952;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus activated spleen cDNA, RIKEN full-length enriched library,
DE   clone:F830001P20 product:arginine vasopressin receptor 1A, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2603
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; dace10bac7591da4a94a03edc0944886.
DR   Ensembl-Gn; ENSMUSG00000020123; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017789; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0017764; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0017727; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017728; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017552; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018183; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017112; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0017521; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0017627; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0017622; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0017701; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017650; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018223; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016897; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017173; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000020323; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027269; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0027239; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0027214; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027217; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027025; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0027721; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0026621; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0026949; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0027073; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0027070; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0027188; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027048; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0027745; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0026326; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0026549; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Dr. John Todd (Dept. of Medical Genetics
CC   Wellcome Trust Centre for Molecular Mechanisms in Disease Wellcome
CC   Trust/MRC building Addenbrookes Hospital Cambridge) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=F830001P20
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2603
FT                   /organism="Mus musculus"
FT                   /strain="NOD"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="F830001P20"
FT                   /tissue_type="activated spleen"
FT                   /db_xref="taxon:10090"
FT   CDS             240..1511
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="arginine vasopressin receptor 1A (MGD|MGI:1859216
FT                   GB|NM_016847, evidence: BLASTN, 99%, match=2602)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q3U1H9"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR001224"
FT                   /db_xref="InterPro:IPR001817"
FT                   /db_xref="InterPro:IPR015076"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1859216"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U1H9"
FT                   /protein_id="BAE33518.1"
FT                   /translation="MSFPRGSHDLPAGNSSPWWPLTTEGANSSREAAGLGEGGSPPGDV
FT                   RNEELAKLEVTVLAVIFVVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQ
FT                   VLPQLCWDITYRFRGPDWLCRVVKHLQVFAMFASSYMLVVMTADRYIAVCHPLKTLQQP
FT                   ARRSRLMIAASWGLSFVLSIPQYFIFSVIEFEVNNGTKAQDCWATFIPPWGTRAYVTWM
FT                   TSGVFVVPVIILGTCYGFICYHIWRNVRGKTASRQSKGGKGSGEAAGPFHKGLLVTPCV
FT                   SSVKSISRAKIRTVKMTFVIVSAYILCWTPFFIVQMWSVWDTNFVWTDSENPSTTITAL
FT                   LASLNSCCNPWIYMFFSGHLLQDCVQSFPCCQSIAQKFAKDDSDSMSRRQTSYSNNRSP
FT                   TNSTGTWKDSPKSSKSIRFIPVST"
XX
SQ   Sequence 2603 BP; 633 A; 628 C; 683 G; 659 T; 0 other;
     gagcctaaga ctgctttggg agcagggaga gtccgctccc ttgcctcgga caagccggag        60
     cagggacacg caagaacatc ccatccaaaa ccactctgag cgcgcgtggg attgcgcagc       120
     gaagagagcg aggtaaggaa ggacggtgcg cagaacttag gacgcgggtc ttcgggtcct       180
     ccgtggagaa gaggaagcag cccacgagga acagggttcc ccggctctgt gccgacagca       240
     tgagtttccc gcgaggctcc cacgatctgc ccgcgggcaa ctccagcccg tggtggcctc       300
     tgaccaccga gggcgccaac agcagccggg aagcagctgg gctcggggaa ggcggcagcc       360
     cgccggggga cgtacgcaac gaggagctgg cgaagctgga ggttaccgtg ctggcggtga       420
     ttttcgtggt ggccgtgctg ggtaatagca gtgtgctgct ggcgctgcat cgcacgccac       480
     gcaagacatc ccgcatgcat ctcttcatcc gacacctcag cctggcagac ctggcggtcg       540
     ccttcttcca agtgttacca cagctgtgct gggacatcac ctaccgcttc cgcgggccgg       600
     actggctgtg ccgggtggtg aagcacttgc aggtgtttgc catgttcgca tcttcctaca       660
     tgctggtggt gatgacggct gaccgctaca tcgccgtgtg ccacccgctc aagaccctgc       720
     agcagcccgc gcgccgctcg cgcctcatga tcgccgcctc ttgggggctg agtttcgttc       780
     tgagcatacc acagtacttt atcttctctg tgatcgaatt tgaggtgaac aatggcacca       840
     aagcccaaga ttgctgggct accttcatcc cgccctgggg tacccgtgcc tacgtgacct       900
     ggatgaccag cggggtcttc gtggtacccg tgatcatctt gggtacctgc tatggcttca       960
     tctgttacca catctggcgc aatgtccgag ggaagacagc atcgcgacag agcaaaggcg      1020
     gcaagggctc tggggaagcc gcgggtccct tccacaaggg gcttctggtc acgccttgtg      1080
     tcagcagcgt gaagagcatt tcccgtgcca agatccgcac agtgaagatg acctttgtga      1140
     ttgtaagcgc ctacatcctc tgctggacac ctttcttcat cgtccagatg tggtcagtct      1200
     gggataccaa tttcgtttgg accgattccg aaaacccttc caccacgatc acggcgttac      1260
     tggcttcctt gaacagctgc tgcaacccgt ggatctacat gttttttagt ggtcatctcc      1320
     tacaagattg tgtccagagc ttcccatgct gccaaagcat agcgcagaaa ttcgccaagg      1380
     atgactcgga tagcatgagc cggagacaga catcttattc taacaaccga agcccaacaa      1440
     acagcactgg gacgtggaag gattcaccta aatcttcaaa gtccatcaga tttatccctg      1500
     tctccacttg agccgcatat ccacgcagcc agactcttgg acggggcttg tgtgtccagc      1560
     tagagagctt aagagtaaat atgtttatgt gacatagaca taaatcaact cagtgtatac      1620
     attgtttcta caacttggtg tatacattgt ttctacaatt cagtgtatac attgtttcta      1680
     gctgtgtttt tcccattgct gtgaccaaaa cctgaattct tttgcatagc atattaatga      1740
     aaatgtacca catgggaaat gtataggcct ggttcgtaag catactgact ttatattttg      1800
     tggttgattt ttttttattg tatttttatg tctaatgtga ggcttggatt ggtttaagtc      1860
     atgtgataag cactgttgtt tctacacaaa gtgaactggt ccgtgattga aaacccagtg      1920
     ttgctgtcaa tctgtgtgtc ataaaatgtc agcaagaggt agagaggagt tgggttgagg      1980
     gtgggaagga ggtagcttgg tacctggctg cccttccttc agagtcctga cactctatta      2040
     gcactgaaaa tcatgctcac caacagacag aaggtttgag aatgttttag gacaataatt      2100
     tgtatggggg ggggtgccac actttataga ggcataagag aaaagatttc tacagacatt      2160
     ctttgggata ttttaaacat ccatggacca gcaccataag gtagtctgtg ctacaccaga      2220
     tgttaacact tagtacctag tcggtgaatc cagattcaga gattctaagt ctcctagata      2280
     actccagaca taagatactc aaaacatgtt gatttaaatc agtttattta tttcttcaca      2340
     tttcccatcc acacagcagg gccagaacac agagggtgaa gacatgtgga gaaacgggag      2400
     acagacagaa agagaggggg gtctgagcct tgtgtctgtt ccttcatgaa tgtatgattt      2460
     tcagaaagat acttaaaaat atttaaagcc ttggtttctt ggctgtacaa tgggcttggt      2520
     aacactcacc tcacagggtt gttgtgaaga ttaaataatg ttaaatgtgt gaagagttat      2580
     ttttaaaaaa aatgtaaagt gct                                              2603
//