Dbfetch

ID   AK155777; SV 1; linear; mRNA; HTC; MUS; 2045 BP.
XX
AC   AK155777;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 12)
XX
DE   Mus musculus B6-derived CD11 +ve dendritic cells cDNA, RIKEN full-length
DE   enriched library, clone:F730219K23 product:cysteine-rich with EGF-like
DE   domains 1, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2045
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; ea69097333cd2b6a7a102cf7241059ae.
DR   Ensembl-Gn; ENSMUSG00000030284; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000032422; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Dr. John Todd (Dept. of Medical Genetics
CC   Wellcome Trust Centre for Molecular Mechanisms in Disease Wellcome
CC   Trust/MRC building Addenbrookes Hospital Cambridge) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=F730219K23
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2045
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="F730219K23"
FT                   /cell_type="B6-derived CD11 +ve dendritic cells"
FT                   /db_xref="taxon:10090"
FT   CDS             345..1607
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="cysteine-rich with EGF-like domains 1
FT                   (MGD|MGI:2152539 GB|BC010804, evidence: BLASTN, 99%,
FT                   match=2034)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q91XD7"
FT                   /db_xref="InterPro:IPR000152"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR001881"
FT                   /db_xref="InterPro:IPR002049"
FT                   /db_xref="InterPro:IPR006212"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR018097"
FT                   /db_xref="InterPro:IPR021852"
FT                   /db_xref="MGI:MGI:2152539"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q91XD7"
FT                   /protein_id="BAE33433.1"
FT                   /translation="MAPLPPRGLVPSLLWCLSLFLSLPGPVWLQPSPPPHPSPRAEPHP
FT                   CHTCRALVDNFNKGLERTIRDNFGGGNTAWEEEKLSKYKDSETRLVEVLEGVCSRSDFE
FT                   CHRLLELSEELVENWWFHRQQEAPDLFQWLCSDSLKLCCPSGTFGPSCLPCPGGTERPC
FT                   GGYGQCEGEGTRGGSGHCDCQAGYGGEACGQCGLGYFEAERNSSHLVCSACFGPCARCT
FT                   GPEESHCLQCKKGWALHHLKCVDIDECGTEQATCGADQFCVNTEGSYECRDCAKACLGC
FT                   MGAGPGRCKKCSRGYQQVGSKCLDVDECETVVCPGENEKCENTEGGYRCVCAEGYRQED
FT                   GICVKEQVPESAGFFAEMTEDEMVVLQQMFFGVIICALATLAAKGDLVFTAIFIGAVAA
FT                   MTGYWLSERSDRVLEGFIKGR"
FT   regulatory      2021..2026
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      2045
FT                   /note="putative"
XX
SQ   Sequence 2045 BP; 400 A; 580 C; 606 G; 459 T; 0 other;
     gctttctctc ggaatatttt gggatccaac cctctctcta attttggccc ctaataactc        60
     actgagaccc taaaacaatg ggctgacgct tattcttttg cccgcgatcc cggccacctc       120
     cccctacggt aacggagaaa taatttctct gctggaatcg tagattaggc tctttcaccc       180
     cttccagcgc ctctgcttcc actaccccag tttatcctcg ttttgtaatt acgtaggtct       240
     ggggctctga gccccaaggc gcctcgcttt cctcccttac agcctggctt ctccagtgaa       300
     ccctccccct gccctctatc tgcacgtccc cagcctggga aaagatggct ccactgcccc       360
     caaggggcct ggtcccatct ctgctctggt gcttgagcct gtttctgagc ctcccaggac       420
     ctgtctggct ccaaccctct cctcctcccc atccttctcc ccgagctgag ccccatccgt       480
     gtcatacctg ccgggcactg gtggacaact tcaacaaggg cctggagaga accatccggg       540
     acaacttcgg gggtggaaac acggcctggg aggaagagaa gttgtccaaa tacaaagaca       600
     gtgagacccg cctggtggag gtgctggagg gcgtgtgcag caggtcagac ttcgagtgcc       660
     accgcctgct cgagctgagc gaggagctgg tggaaaactg gtggtttcac aggcagcagg       720
     aagcccccga cctcttccag tggctctgtt ccgattccct gaagctctgc tgcccctctg       780
     gcacctttgg gccctcctgc ctgccatgtc ctgggggcac agagaggccc tgcggtggct       840
     acgggcagtg tgaaggggaa gggactcgag ggggcagcgg gcactgtgac tgccaagccg       900
     gctatggggg cgaggcctgt ggccagtgtg gccttggcta ctttgaggcg gagcgcaaca       960
     gcagccatct ggtatgttcg gcgtgttttg gtccttgtgc ccgctgcacg ggacctgagg      1020
     aatcccattg tctgcagtgc aagaaaggct gggccctgca tcacctcaag tgtgtagaca      1080
     tcgatgagtg tggtacagag caagccacct gtggagctga ccagttctgt gtgaacacag      1140
     aaggatccta cgagtgccga gactgtgcaa aggcctgcct gggctgtatg ggagcagggc      1200
     cagggcgctg caaaaagtgc agccgtggct accagcaggt gggctcaaag tgcctagatg      1260
     tggatgagtg tgagactgtg gtgtgtccag gagagaatga gaagtgtgaa aacacggagg      1320
     gaggctaccg ctgtgtctgt gctgagggct acagacagga ggacggcatc tgcgtgaagg      1380
     agcaggtccc ggagtcggcg ggcttctttg cggagatgac ggaggatgaa atggtggttc      1440
     tgcagcagat gttctttggt gtaatcatct gtgcgctggc cacgcttgct gccaagggtg      1500
     acttggtgtt cactgccatc ttcattggag ctgtggcagc catgactggg tactggttgt      1560
     cagagcggag tgaccgtgtg ctggagggct tcatcaaggg tagataatcc ctgccgccac      1620
     tcacaggatt tcctcccacc caggctgctc ctagaggtta tttctctctc cctatggata      1680
     cctgggacag catagtttct ctttgagact ggggtaaaca cccttttacc tgccttactg      1740
     agcagcccag gaccccagtg gccccagggg gttgaaaaag aggtcctgaa gcagatgcca      1800
     cgagatccta gcctaggaca ctggcaggcc tcaccgtgta tgaatcccaa gacagtttct      1860
     ccccagggag gttgcaggtg ggctttggcc cctgacccgg atgagaggtg tcccctcagg      1920
     ggtgggcccc cataggcccc ttgccaggtg catgctgcca gctccagctg tgtattcacc      1980
     gcccacgccc tagccatcga cttatttatt catctcagga aataaaggac ggtcttgaaa      2040
     atggg                                                                  2045
//