spacer

EBI Dbfetch

ID   AK155567; SV 1; linear; mRNA; HTC; MUS; 4196 BP.
XX
AC   AK155567;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus NOD-derived CD11c +ve dendritic cells cDNA, RIKEN full-length
DE   enriched library, clone:F630326L07 product:AXL receptor tyrosine kinase,
DE   full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4196
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 0d23f472d609f2db0b85232f8a462b7e.
DR   Ensembl-Gn; ENSMUSG00000002602; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000002677; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Dr. John Todd (Dept. of Medical Genetics
CC   Wellcome Trust Centre for Molecular Mechanisms in Disease Wellcome
CC   Trust/MRC building Addenbrookes Hospital Cambridge) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=F630326L07
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4196
FT                   /organism="Mus musculus"
FT                   /strain="NOD"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="F630326L07"
FT                   /cell_type="NOD-derived CD11c +ve dendritic cells"
FT                   /db_xref="taxon:10090"
FT   CDS             142..2808
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="AXL receptor tyrosine kinase (MGD|MGI:1347244
FT                   GB|BC046618, evidence: BLASTN, 100%, match=4136)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q00993"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR020635"
FT                   /db_xref="MGI:MGI:1347244"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q00993"
FT                   /protein_id="BAE33327.1"
FT                   /translation="MGRVPLAWWLALCCWGCAAHKDTQTEAGSPFVGNPGNITGARGLT
FT                   GTLRCELQVQGEPPEVVWLRDGQILELADNTQTQVPLGEDWQDEWKVVSQLRISALQLS
FT                   DAGEYQCMVHLEGRTFVSQPGFVGLEGLPYFLEEPEDKAVPANTPFNLSCQAQGPPEPV
FT                   TLLWLQDAVPLAPVTGHSSQHSLQTPGLNKTSSFSCEAHNAKGVTTSRTATITVLPQRP
FT                   HHLHVVSRQPTELEVAWTPGLSGIYPLTHCNLQAVLSDDGVGIWLGKSDPPEDPLTLQV
FT                   SVPPHQLRLEKLLPHTPYHIRISCSSSQGPSPWTHWLPVETTEGVPLGPPENVSAMRNG
FT                   SQVLVRWQEPRVPLQGTLLGYRLAYRGQDTPEVLMDIGLTREVTLELRGDRPVANLTVS
FT                   VTAYTSAGDGPWSLPVPLEPWRPGQGQPLHHLVSEPPPRAFSWPWWYVLLGALVAAACV
FT                   LILALFLVHRRKKETRYGEVFEPTVERGELVVRYRVRKSYSRRTTEATLNSLGISEELK
FT                   EKLRDVMVDRHKVALGKTLGEGEFGAVMEGQLNQDDSILKVAVKTMKIAICTRSELEDF
FT                   LSEAVCMKEFDHPNVMRLIGVCFQGSDREGFPEPVVILPFMKHGDLHSFLLYSRLGDQP
FT                   VFLPTQMLVKFMADIASGMEYLSTKRFIHRDLAARNCMLNENMSVCVADFGLSKKIYNG
FT                   DYYRQGRIAKMPVKWIAIESLADRVYTSKSDVWSFGVTMWEIATRGQTPYPGVENSEIY
FT                   DYLRQGNRLKQPVDCLDGLYALMSRCWELNPRDRPSFAELREDLENTLKALPPAQEPDE
FT                   ILYVNMDEGGSHLEPRGAAGGADPPTQPDPKDSCSCLTAADVHSAGRYVLCPSTAPGPT
FT                   LSADRGCPAPPGQEDGA"
XX
SQ   Sequence 4196 BP; 947 A; 1150 C; 1109 G; 990 T; 0 other;
     gggagttgag ccagccgagg ggctcccgct gtgccaggcg ggcagtgcca aatcccagga        60
     gccctgcccc ctttcctagc gaggtgccca tcaacttcgg aagaaagttt ggcatcaatc       120
     tgagctgttg gtgtctggag gatgggcagg gtcccgctgg cctggtggtt ggcgctgtgc       180
     tgctgggggt gtgcagccca taaggacaca cagaccgagg ctggcagccc gtttgtgggg       240
     aacccaggga atatcacagg tgccagagga ctcacgggga cacttcggtg tgagctccag       300
     gttcaggggg aaccccctga ggtggtgtgg cttcgagatg gacagatcct agaactggct       360
     gataacaccc agacccaggt gcctctgggc gaagactggc aagatgaatg gaaagttgtc       420
     agtcagctca gaatctcagc cctgcaactt tcagatgcag gggagtacca gtgtatggtg       480
     catctagaag gacggacctt tgtgtctcag ccgggctttg tagggctgga aggtctcccg       540
     tacttcctgg aggagcctga ggacaaagct gtgcctgcca acaccccttt caacctaagc       600
     tgccaggccc agggaccccc ggaacccgtg accctactct ggcttcaaga tgctgtcccc       660
     ctggccccag tcacaggaca cagctcccag cacagtctgc aaactccagg cctgaacaag       720
     acatcttctt tctcatgtga agcccacaat gccaagggag tcaccacctc ccgcacagcc       780
     accatcacag tgctccccca gaggcctcac catctccacg tggtttccag acaacctacg       840
     gagctagagg tagcttggac ccctggcctg agtggcatct acccgctcac ccactgcaac       900
     ctgcaggccg tgctgtcaga cgatggggtg ggtatctggc tgggaaagtc agatcctcct       960
     gaagaccccc tcaccttgca agtatcagtg cccccccacc agcttcggct ggaaaagctc      1020
     cttcctcaca ccccgtatca catccggata tcctgcagca gcagccaggg cccctcacct      1080
     tggacccact ggcttcctgt ggagaccaca gagggagtgc ccttgggtcc ccctgagaac      1140
     gttagcgcca tgcggaatgg gagccaggtc ctcgtgcgtt ggcaggagcc aagggtgccc      1200
     ctgcaaggca ccctgttagg gtaccggctg gcatatcgag gccaggacac ccccgaggta      1260
     cttatggata tagggctaac tcgagaggtg accttggaac tgcgggggga caggcctgtg      1320
     gctaacctga ctgtgtctgt gacagcctat acctcggctg gggatgggcc ctggagcctt      1380
     cctgtgcccc tagagccctg gcgcccaggg caaggacagc cactccacca tctggtgagt      1440
     gaacccccac ctcgcgcctt ctcgtggcct tggtggtatg tactgctggg agcacttgtg      1500
     gctgccgcct gcgtcctcat cttggccctg ttccttgtcc atcggaggaa gaaggagact      1560
     cgatatgggg aggtgtttga gccaaccgtg gaaagaggtg aactggtagt caggtaccgt      1620
     gtccgaaagt cctacagccg gcggaccact gaagccacct tgaacagtct gggcatcagt      1680
     gaagagctga aggagaaact acgagacgtc atggtagatc ggcataaggt ggccttgggg      1740
     aagaccctgg gagaaggaga atttggcgct gtgatggaag gtcagctcaa tcaggatgac      1800
     tccatcctca aggtcgctgt gaagaccatg aaaattgcca tctgcacaag atcagagctg      1860
     gaggatttcc tgagtgaagc tgtctgcatg aaggaatttg accaccccaa cgtcatgagg      1920
     ctcattggcg tctgttttca gggctctgac agagagggtt tcccagaacc tgtggtcatc      1980
     ttgcctttca tgaaacacgg agacctacac agtttcctcc tgtactcccg gctcggggac      2040
     cagccagtgt tcctgcccac tcagatgcta gtgaagttca tggccgacat tgccagtggt      2100
     atggagtacc tgagtaccaa gagattcata catcgggacc tggctgccag gaactgcatg      2160
     ctgaatgaga acatgtccgt gtgtgtggca gacttcgggc tctccaagaa gatctacaac      2220
     ggggattact accgccaagg gcgcattgcc aagatgccag tcaagtggat tgctattgag      2280
     agtctggcag atcgggtcta caccagcaag agcgatgtgt ggtccttcgg tgtgacaatg      2340
     tgggagatcg ccacccgagg ccaaactccc tatccagggg tggagaacag tgagatttac      2400
     gactacctgc gtcaaggaaa tcggctgaaa cagcctgtgg actgtctgga cggcctgtat      2460
     gccctgatgt ctcggtgctg ggaactgaac cctcgagacc ggccaagttt tgcggagctc      2520
     cgggaagact tggagaacac actgaaggct ctgccccctg ctcaggagcc agatgaaatc      2580
     ctctatgtca acatggatga gggcggaagc caccttgaac cccgtggggc tgctggagga      2640
     gctgaccccc caacccaacc tgatcctaag gattcctgta gctgtctcac tgcagctgac      2700
     gtccactcag ctggacgcta tgtcctttgt ccttctacag ccccaggacc cactctgtct      2760
     gctgacagag gctgcccagc acctccaggg caggaggacg gagcctgaga caatcttcca      2820
     cctgggacat cctctcagga cccaagctag gcactgccac tgggggaaag ctcacccccc      2880
     cactccgtca ctccaggcct tctccccaga tgcagaatgg ccttccctcc cttctcagat      2940
     gcagtccatg ccttatgcac cctatccata acagtttcaa gggatcgtct cacatcttcc      3000
     atcccagcgt tctagatttt aaggtttgag tttagagttc aaagttctca aagatgatga      3060
     gtctttggac cgagatgctt gtttctaggt ctgcagcgct gttgctatag acaggcccac      3120
     tgctcgaagg ctctgagatt ctatggctct agatttttct ggctctataa ttcgtggcaa      3180
     tgctcccatg gttttaggtt gcacgactct gagattccag gacctaaggc ttctagactt      3240
     tatttttctg gagccagggg tcctgtcagt ggaagattgt agatttttaa attctaaaga      3300
     ttctaggcat gaaggttcta aggcatactg cttctccagt ttaacagttt agggctcatg      3360
     ttggaatact ccagatcata atgtttcaaa cttttatttt ttttaatttc taagacccca      3420
     gtgatggtca actacagatt ctgaagcctt atgaccatag attcttttat ataaaaatcc      3480
     tgtatctcaa ggaaatatga ttctagactc tgaaattcca aagctttaag agtctccaga      3540
     tggagtttct aagctatgat gtggtgataa tctaaagttt agtccaaggt tctagattcc      3600
     taagcttcca cgtcatctgc tcccaggatt ccagattatt aaactctaaa actctaatgt      3660
     tggcctgatc ttcgtctcag gccctgtagg atgctgtggg tcctcagcat ctaagtcaca      3720
     agaggctcca gttaacgagg actaatgaga caccaaagtt ctaaccactt ctaatgctgg      3780
     acacctctag gttctatgct gctttttgcc tttctagcac ataattaaat gcccaagaat      3840
     acatatgtct aaagatctta aatctctaag cactatggag ccaatgtttt gagtgtctga      3900
     gattctaaag gtccacagtc tagagtatta ggtacgactc caagggtggg cgcttgtagc      3960
     catcctaagt cctttccctc cttaagcacc tatgctcctc ctctccttgt gtggggtaca      4020
     ccccacctta agcctgtgcg atgcactggg aatgcctgct ttcctccaag ggatgggtca      4080
     tctcccctca tttggggcca tgttgcccct tgagccagtc ccctatgcct gttctgaagt      4140
     gtggactctg gtgcctccag agaggctcag atcacataaa acttttgtca gtcact          4196
//


spacer
spacer