Dbfetch

ID   AK155388; SV 1; linear; mRNA; HTC; MUS; 3937 BP.
XX
AC   AK155388;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus NOD-derived CD11c +ve dendritic cells cDNA, RIKEN full-length
DE   enriched library, clone:F630223K22 product:solute carrier family 27 (fatty
DE   acid transporter), member 4, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3937
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 69dd1f292c82b17c8208aebdbb4eb189.
DR   Ensembl-Gn; ENSMUSG00000059316; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025544; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0025522; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0025491; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025517; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025279; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025962; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024742; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0025256; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0025389; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0025352; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0025475; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025382; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026021; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024488; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024810; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000080065; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0053664; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0053678; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0053632; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0053621; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0053356; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054113; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0053522; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0053301; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0053410; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0053372; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0053518; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0053357; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0054249; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053124; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0052633; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Dr. John Todd (Dept. of Medical Genetics
CC   Wellcome Trust Centre for Molecular Mechanisms in Disease Wellcome
CC   Trust/MRC building Addenbrookes Hospital Cambridge) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=F630223K22
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3937
FT                   /organism="Mus musculus"
FT                   /strain="NOD"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="F630223K22"
FT                   /cell_type="NOD-derived CD11c +ve dendritic cells"
FT                   /db_xref="taxon:10090"
FT   CDS             258..2189
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="solute carrier family 27 (fatty acid transporter),
FT                   member 4 (MGD|MGI:1347347 GB|AK036919, evidence: BLASTN,
FT                   99%, match=3936)"
FT                   /db_xref="GOA:Q91VE0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR022272"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR030304"
FT                   /db_xref="MGI:MGI:1347347"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q91VE0"
FT                   /protein_id="BAE33236.1"
FT                   /translation="MLLGASLVGALLFSKLVLKLPWTQVGFSLLLLYLGSGGWRFIRVF
FT                   IKTVRRDIFGGMVLLKVKTKVRRYLQERKTVPLLFASMVQRHPDKTALIFEGTDTHWTF
FT                   RQLDEYSSSVANFLQARGLASGNVVALFMENRNEFVGLWLGMAKLGVEAALINTNLRRD
FT                   ALRHCLDTSKARALIFGSEMASAICEIHASLEPTLSLFCSGSWEPSTVPVSTEHLDPLL
FT                   EDAPKHLPSHPDKGFTDKLFYIYTSGTTGLPKAAIVVHSRYYRMASLVYYGFRMRPDDI
FT                   VYDCLPLYHSAGNIVGIGQCLLHGMTVVIRKKFSASRFWDDCIKYNCTIVQYIGELCRY
FT                   LLNQPPREAESRHKVRMALGNGLRQSIWTDFSSRFHIPQVAEFYGATECNCSLGNFDSR
FT                   VGACGFNSRILSFVYPIRLVRVNEDTMELIRGPDGVCIPCQPGQPGQLVGRIIQQDPLR
FT                   RFDGYLNQGANNKKIANDVFKKGDQAYLTGDVLVMDELGYLYFRDRTGDTFRWKGENVS
FT                   TTEVEGTLSRLLHMADVAVYGVEVPGTEGRAGMAAVASPISNCDLESFAQTLKKELPLY
FT                   ARPIFLRFLPELHKTGTFKFQKTELRKEGFDPSVVKDPLFYLDARKGCYVALDQEAYTR
FT                   IQAGEEKL"
FT   regulatory      3918..3923
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      3937
FT                   /note="putative"
XX
SQ   Sequence 3937 BP; 802 A; 1108 C; 1121 G; 906 T; 0 other;
     gagaagctcg ccctctgcgg ggacggcaca gaaggcggtg ctgccggctg gcacagccgg        60
     tgcgggtgcg ggaggcgggt gggggtggag cggggcagag gtacagaccc tacaaggacg       120
     aggagtgggc cagacgcacc gaggctcggc tgtgtgtgcc ccggggcggc cgatgccccc       180
     agcgcaccgc actccgctgc cgcaaccggg ccgcatcctg acggggcgcc gcgccgcgca       240
     gccgcagccg ggtcacaatg ctacttggag catctctggt gggggcgcta ctgttctcca       300
     agctagtgct gaagctgccc tggacccagg tgggattctc cctgttgctc ctgtacttgg       360
     ggtctggtgg ctggcgtttc atccgggtct tcatcaagac ggtcaggaga gatatctttg       420
     gtggcatggt gctcctgaag gtgaagacca aggtgcgacg gtaccttcag gagcggaaga       480
     cggtgcccct gctgtttgct tcaatggtac agcgccaccc ggacaagaca gccctgattt       540
     tcgagggcac agacactcac tggaccttcc gccagctgga tgagtactcc agtagtgtgg       600
     ccaacttcct gcaggcccgg ggcctggcct caggcaatgt agttgccctc tttatggaaa       660
     accgcaatga gtttgtgggt ctgtggctag gcatggccaa gctgggcgtg gaggcggctc       720
     tcatcaacac caaccttagg cgggatgccc tgcgccactg tcttgacacc tcaaaggcac       780
     gagctctcat ctttggcagt gagatggcct cagctatctg tgagatccat gctagcctgg       840
     agcccacact cagcctcttc tgctctggat cctgggagcc cagcacagtg cccgtcagca       900
     cagagcatct ggaccctctt ctggaagatg ccccgaagca cctgcccagt cacccagaca       960
     agggttttac agataagctc ttctacatct acacatcggg caccacgggg ctacccaaag      1020
     ctgccattgt ggtgcacagc aggtattatc gtatggcttc cctggtgtac tatggattcc      1080
     gcatgcggcc tgatgacatt gtctatgact gcctccccct ctaccactca gcaggaaaca      1140
     tcgtggggat tggccagtgc ttactccacg gcatgactgt ggtgatccgg aagaagttct      1200
     cagcctcccg gttctgggat gattgtatca agtacaactg cacaattgta cagtacattg      1260
     gcgagctctg ccgctacctc ctgaaccagc caccccgtga ggctgagtct cggcacaagg      1320
     tgcgcatggc actgggcaac ggtctccggc agtccatctg gaccgacttc tccagccgtt      1380
     tccacatccc ccaggtggct gagttctatg gggccactga atgcaactgt agcctgggca      1440
     actttgacag ccgggtgggg gcctgtggct tcaatagccg catcctgtcc tttgtgtacc      1500
     ctatccgttt ggtacgtgtc aatgaggata ccatggaact gatccgggga cccgatggag      1560
     tctgcattcc ctgtcaacca ggtcagccag gccagctggt gggtcgcatc atccagcagg      1620
     accctctgcg ccgtttcgac gggtacctca accagggtgc caacaacaag aagattgcta      1680
     atgatgtctt caagaagggg gaccaagcct acctcactgg tgacgtcctg gtgatggatg      1740
     agctgggtta cctgtacttc cgagatcgca ctggggacac gttccgctgg aaaggggaga      1800
     atgtatctac cactgaggtg gagggcacac tcagccgcct gcttcatatg gcagatgtgg      1860
     cagtttatgg tgttgaggtg ccaggaactg aaggccgagc aggaatggct gccgttgcaa      1920
     gtcccatcag caactgtgac ctggagagct ttgcacagac cttgaaaaag gagctgcctc      1980
     tgtatgcccg ccccatcttc ctgcgcttct tgcctgagct gcacaagaca gggaccttca      2040
     agttccagaa gacagagttg cggaaggagg gctttgaccc atctgttgtg aaagacccgc      2100
     tgttctatct ggatgctcgg aagggctgct acgttgcact ggaccaggag gcctataccc      2160
     gcatccaggc aggcgaggag aagctgtgat ttccccctac atccctctga gggccagaag      2220
     atgctggatt cagagcccta gcgtccaccc cagaggggtc ctgggcaatg ccagaccaaa      2280
     gctagcaggg cccgcacctc cgcccctagg tgctgatctc ccctctccca aactgccaag      2340
     tgactcactg ccgcttcccc gaccctccag aggctttctg tgaaagtctc atccaagctg      2400
     tgtcttctgg tccaggcgtg gcccctggcc ccagggtttc tgataggctc ctttaggatg      2460
     gtatcttggg tccagcgggc cagggtgtgg gagaggagtc actaagatcc ctccaatcag      2520
     aagggagctt acaaaggaac caaggcaaag cctgtagact caggaagcta agtggccaga      2580
     gactatagtg gccagtcatc ccatgtccac agaggatctt ggtccagagc tgccaaagtg      2640
     tcacctctcc ctgcctgcac ctctggggaa aagaggacag catgtggcca ctgggcacct      2700
     gtctcaagaa gtcaggatca cacactcagt ccttgtttct ccaggttccc ttgttcttgt      2760
     ctcggggagg gagggacgag tgtcctgtct gtccttcctg cctgtctgtg agtctgtgtt      2820
     gcttctccat ctgtcctagc ctgagtgtgg gtggaacagg catgaggaga gtgtggctca      2880
     ggggccaata aactctgcct tgactcctct tagcctgaca gcctggctcc ttgcctacct      2940
     ccttcccctc tagccccttt cgcttagccc ttgggataag cccttagcca gtcctctttt      3000
     ccaaagctct gccttcctat aactccttag gagagactcc caccagatct gacaggatgt      3060
     taaactttgg aacttaacct ttaaagtaag catgtggctt tgggcaagtg tctcctgaat      3120
     tatgggggta attaagggat tcagaaacta cacaaagcca ttaggagtgg gaggatactt      3180
     ggcgtctttg agggaaagcc ctcccctgca cagaactgtc catggaccca tgcgctgttg      3240
     ctccatcttc tgccaaatga cccattggag cctccccagc cctctgaggc tttctatgaa      3300
     agtttcatgt ctaagctctg tcttcttggc caggaggcct ctgcacccgg gctgagactg      3360
     acaggcacct ttaggatgat gcatctgatc cagacagact gcctgacctc ctcaggcaac      3420
     cctagccagt cagcagcaca ttggtccaga gtcctccagc ctgggagtcc ctgggaagta      3480
     cagagggtcc taacagccca gggtggactg ctcaagggcc ctcctccact gttggacctt      3540
     ctcctgtatc tgtgaggtca atttcttgag ttctgagatg gttttgtgtg gtcctgattg      3600
     ccattttact tgggtacgat gtggagaatg gctttgacct caggatcttt ctgcttcctc      3660
     ccaggtgctg ggatgaaaga catctggctt gagtggtttt gttgtggtta tgtgcgcatg      3720
     actcaggttt ctgcaaacat gagtccagag gcctcagaat cccctggagc tggaattaaa      3780
     gggggggggg ttctaggagc taacctgggt ctcaaagcac atttttttgg gggggggtgt      3840
     tgattggtgt tcaagacaca gtttctctat gtaacagctc tgaacttaca aagatccgcc      3900
     tgctccagag tgcagagatt aaatgtgtac caccacc                               3937
//