spacer

EBI Dbfetch

ID   AK155378; SV 1; linear; mRNA; HTC; MUS; 1417 BP.
XX
AC   AK155378;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 12)
XX
DE   Mus musculus NOD-derived CD11c +ve dendritic cells cDNA, RIKEN full-length
DE   enriched library, clone:F630223A09 product:1-acyl-sn-glycerol-3-phosphate
DE   acyltransferase epsilon (EC 2.3.1.51) (1-AGP acyltransferase 5) (1-AGPAT 5)
DE   (Lysophosphatidic acid acyltransferase-epsilon) (LPAAT-epsilon)
DE   (1-acylglycerol-3-phosphate O-acyltransferase 5), full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1417
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; ca703ef8cbd3dc7bc1f679c0c0b86650.
DR   Ensembl-Gn; ENSMUSG00000031467; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000149565; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Dr. John Todd (Dept. of Medical Genetics
CC   Wellcome Trust Centre for Molecular Mechanisms in Disease Wellcome
CC   Trust/MRC building Addenbrookes Hospital Cambridge) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=F630223A09
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1417
FT                   /organism="Mus musculus"
FT                   /strain="NOD"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="F630223A09"
FT                   /cell_type="NOD-derived CD11c +ve dendritic cells"
FT                   /db_xref="taxon:10090"
FT   CDS             231..1328
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="1-acyl-sn-glycerol-3-phosphate acyltransferase
FT                   epsilon (EC 2.3.1.51) (1-AGP acyltransferase 5) (1-AGPAT 5)
FT                   (Lysophosphatidic acid acyltransferase-epsilon)
FT                   (LPAAT-epsilon) (1-acylglycerol-3-phosphate
FT                   O-acyltransferase 5) (UniProt|Q9D1E8, evidence: FASTY,
FT                   100%ID, 100%length, match=1095)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q9D1E8"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="MGI:MGI:1196345"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9D1E8"
FT                   /protein_id="BAE33229.1"
FT                   /translation="MLLSLVLHTYSMRYLLPSVLLLGSAPTYLLAWTLWRVLSALMPAR
FT                   LYQRVDDRLYCVYQNMVLFFFENYTGVQILLYGDLPKNKENVIYLANHQSTVDWIVADM
FT                   LAARQDALGHVRYVLKDKLKWLPLYGFYFAQHGGIYVKRSAKFNDKEMRSKLQSYVNAG
FT                   TPMYLVIFPEGTRYNATYTKLLSASQAFAAQRGLAVLKHVLTPRIKATHVAFDSMKSHL
FT                   DAIYDVTVVYEGNEKGSGKYSNPPSMTEFLCKQCPKLHIHFDRIDRNEVPEEQEHMKKW
FT                   LHERFEIKDRLLIEFYDSPDPERRNKFPGKSVHSRLSVKKTLPSVLILGSLTAVMLMTE
FT                   SGRKLYMGTWLYGTLLGCLWFVIKA"
FT   polyA_signal    1395..1400
FT                   /note="putative"
FT   polyA_site      1417
FT                   /note="putative"
XX
SQ   Sequence 1417 BP; 367 A; 334 C; 385 G; 331 T; 0 other;
     ggacaagcac gggtcgcgcg gagcaaagcg agcaccccga ggcgagtgcg cccggcaagc        60
     cgaggcgtgc cctttccaag gcggcgagca gaggccgtca ctgtccccgc cgggtcccgg       120
     gcccccgcgg cccatgctgg gggcggagcc agggcggagg gcggcggtgg ctgaggtcct       180
     ggtggccgcg cgggcaacgc aggcggagtc gcggctggcg agccgagagg atgctgctgt       240
     ccctggtgct ccacacgtac tctatgcgct acctgctccc cagcgtcctg ttgctgggct       300
     cggcgcccac ctacctgctg gcctggacgc tgtggcgggt gctctccgcg ctgatgcccg       360
     cccgcctgta ccagcgcgtg gacgaccggc tttactgcgt ctaccagaac atggtgctct       420
     tcttcttcga gaactacacc ggggtccaga tattgctata tggagatttg ccaaaaaata       480
     aagaaaatgt aatatatcta gcgaatcatc aaagcacagt tgactggatt gttgcggaca       540
     tgctggctgc cagacaggat gccctaggac atgtgcgcta cgtactgaaa gacaagttaa       600
     aatggcttcc gctgtatggg ttctactttg ctcagcatgg aggaatttat gtaaaacgaa       660
     gtgccaaatt taatgataaa gaaatgagaa gcaagctgca gagctatgtg aacgcaggaa       720
     caccgatgta tcttgtgatt ttcccagagg gaacaaggta taatgcaaca tacacaaaac       780
     tcctttcagc cagtcaggca tttgctgctc agcggggcct tgcagtatta aaacacgtac       840
     tgacaccaag aataaaggcc actcacgttg cttttgattc tatgaagagt catttagatg       900
     caatttatga tgtcacagtg gtttatgaag ggaatgagaa aggttcagga aaatactcaa       960
     atccaccatc catgactgag tttctctgca aacagtgccc aaaacttcat attcactttg      1020
     atcgtataga cagaaatgaa gttccagagg aacaagaaca catgaaaaag tggcttcatg      1080
     agcgctttga gataaaagat aggttgctca tagagttcta tgattcacca gatccagaaa      1140
     gaagaaacaa atttcctggg aaaagtgttc attccagact aagtgtgaag aagactttac      1200
     cttcagtgtt gatcttgggg agtttgactg cggtcatgct gatgacggag tccggaagga      1260
     aactgtacat gggcacctgg ttgtatggaa ccctccttgg ctgcctgtgg tttgttatta      1320
     aagcataagc aagtagcagg ctgcagtcac agtctcttat tgatggctac acattgtatc      1380
     acattgtttc ctgaattaaa taaggagttt tcttgtc                               1417
//


spacer
spacer