Dbfetch

ID   AK155292; SV 1; linear; mRNA; HTC; MUS; 1221 BP.
XX
AC   AK155292;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus NOD-derived CD11c +ve dendritic cells cDNA, RIKEN full-length
DE   enriched library, clone:F630215J21 product:N-acetylglucosamine kinase, full
DE   insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1221
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; bf60ab236df2ba2dc1674a462aa23d1f.
DR   Ensembl-Gn; ENSMUSG00000034744; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0030941; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0030910; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0030838; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0030920; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031380; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030029; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0030607; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0030760; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0030713; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0030839; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030749; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031404; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029744; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0030110; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000037376; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0078375; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0078451; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0078368; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0078394; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0078860; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0078590; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0077971; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0078133; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0078021; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0078161; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0078021; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0079103; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0078015; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0077124; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Dr. John Todd (Dept. of Medical Genetics
CC   Wellcome Trust Centre for Molecular Mechanisms in Disease Wellcome
CC   Trust/MRC building Addenbrookes Hospital Cambridge) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=F630215J21
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1221
FT                   /organism="Mus musculus"
FT                   /strain="NOD"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="F630215J21"
FT                   /cell_type="NOD-derived CD11c +ve dendritic cells"
FT                   /db_xref="taxon:10090"
FT   CDS             90..1121
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="N-acetylglucosamine kinase (MGD|MGI:1860418
FT                   GB|NM_019542, evidence: BLASTN, 99%, match=1220)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q3U2G9"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="MGI:MGI:1860418"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U2G9"
FT                   /protein_id="BAE33171.1"
FT                   /translation="MAALYGGVEGGGTRSKVLLLSEDGQILAEADGLSTNHWLIGTDQC
FT                   VERINEMVDRAKQKAGVDPLVPLRSLGLSLSGGEQEDAVRLLIEELRHRFPNLSENYLI
FT                   TTDAAGSIATATPDGGIVLISGTGSNCRLINPDGSESGCGGWGHMMGDEGSAYWIAHQA
FT                   VKIVFDSIDNLEAAPHDIGHVKQAMFDYFQVPDRLGILTHLYRDFDKCKFAGFCQKIAE
FT                   GAHQGDPLSRYIFRKAGEMLGRHVVAVLPEIDPVLFQGELGLPILCVGSVWKSWELLKE
FT                   GFLLALTLGREQQAQNSFSSFTLMKLRHSSALGGASLGARHIGYHLPMDYSINAIAFYS
FT                   YTF"
FT   regulatory      1197..1202
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      1221
FT                   /note="putative"
XX
SQ   Sequence 1221 BP; 277 A; 300 C; 367 G; 277 T; 0 other;
     gatgacaagg ggcggtgccc gtgtgggcgg gagcgaagtc acggctaggg tcgaggttgc        60
     tacggcgaac cagcggtggc aacggtagta tggccgcgct ttatggtggc gtggaagggg       120
     gaggcacacg gtccaaagtc cttttacttt ctgaggatgg gcagatcctg gcagaagcag       180
     atggactgag cacaaaccac tggctgattg gcacagacca gtgtgtggag aggatcaatg       240
     agatggtgga cagggccaaa cagaaggctg gagtggatcc tctggtgccc cttcgaagcc       300
     tgggcctgtc cctgagtggt ggggagcagg aggatgcagt gaggctcctg attgaggagt       360
     tgaggcaccg ctttcccaac ctgagtgaaa actacttaat caccacggat gcagcaggtt       420
     ccatcgccac agccacaccg gacggtggga ttgtgctcat ctctggaaca ggctccaact       480
     gtaggcttat caaccctgat ggctccgaga gtggctgtgg aggctggggc cacatgatgg       540
     gagacgaggg ctcagcctac tggattgcac accaagctgt gaaaattgtg tttgattcca       600
     tcgacaacct ggaggcagct cctcatgata ttggccatgt caagcaggcc atgttcgact       660
     atttccaggt gccagatcgg cttggaatcc tcacccattt gtatagggac tttgataaat       720
     gcaagtttgc tggattttgc cagaaaattg cagaaggtgc acatcaggga gaccctcttt       780
     ccaggtacat cttcaggaag gctggagaga tgctgggcag acatgttgtg gcagtattgc       840
     cagagattga cccggttttg ttccaagggg agcttggcct ccccattctg tgtgtgggct       900
     cagtgtggaa gagctgggag ctcctgaagg aaggctttct cctggcgctg acgctgggcc       960
     gagagcagca ggcacagaac tccttctcca gcttcaccct gatgaagttg cggcattctt      1020
     ctgcattggg gggtgccagc ctgggggcca ggcacattgg ataccacctt cccatggact      1080
     acagtatcaa tgccattgcc ttctattcct ataccttcta gagtctgtcc ccctgcccaa      1140
     ccagccaaca ccgagagctg ggagactttc ctttttaaaa aacacatatg gaagaaaata      1200
     aatgcacttt actccttccc t                                                1221
//