spacer

EBI Dbfetch

ID   AK155200; SV 1; linear; mRNA; HTC; MUS; 4686 BP.
XX
AC   AK155200;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus NOD-derived CD11c +ve dendritic cells cDNA, RIKEN full-length
DE   enriched library, clone:F630208D12 product:nuclear receptor subfamily 3,
DE   group C, member 1, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4686
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; fde1e25a28e6deb2fd87222c114ee527.
DR   Ensembl-Gn; ENSMUSG00000024431; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000025300; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115567; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115571; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Dr. John Todd (Dept. of Medical Genetics
CC   Wellcome Trust Centre for Molecular Mechanisms in Disease Wellcome
CC   Trust/MRC building Addenbrookes Hospital Cambridge) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=F630208D12
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4686
FT                   /organism="Mus musculus"
FT                   /strain="NOD"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="F630208D12"
FT                   /cell_type="NOD-derived CD11c +ve dendritic cells"
FT                   /db_xref="taxon:10090"
FT   CDS             123..2474
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="nuclear receptor subfamily 3, group C, member 1
FT                   (MGD|MGI:95824 GB|NM_008173, evidence: BLASTN, 99%,
FT                   match=2570)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q3U2M7"
FT                   /db_xref="InterPro:IPR000536"
FT                   /db_xref="InterPro:IPR001409"
FT                   /db_xref="InterPro:IPR001628"
FT                   /db_xref="InterPro:IPR001723"
FT                   /db_xref="InterPro:IPR008946"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="MGI:MGI:95824"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U2M7"
FT                   /protein_id="BAE33113.1"
FT                   /translation="MDSKESLAPPGRDEVPSSLLGRGRGSVMDLYKTLRGGATVKVSAS
FT                   SPSVAAASQADSKQQRILLDFSKGSASNAQQQQQQQQPQPDLSKAVSLSMGLYMGETET
FT                   KVMGNDLGYPQQGQLGLSSGETDFRLLEESIANLNRSTSRPENPKSSTPAAGCATPTEK
FT                   EFPQTHSDPSSEQQNRKSQPGTNGGSVKLYTTDQSTFDILQDLEFSAGSPGKETNESPW
FT                   RSDLLIDENLLSPLAGEDDPFLLEGDVNEDCKPLILPDTKPKIQDTGDTILSSPSSVAL
FT                   PQVKTEKDDFIELCTPGVIKQEKLGPVYCQASFSGTNIIGNKMSAISVHGVSTSGGQMY
FT                   HYDMNTASLSQQQDQKPVFNVIPPIPVGSENWNRCQGSGEDNLTSLGAMNFAGRSVFSN
FT                   GYSSPGMRPDVSSPPSSSSTATGPPPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEG
FT                   QHNYLCAGRNDCIIDKIRRKNCPACRYRKCLQAGMNLEARKTKKKIKGIQQATAGVSQD
FT                   TSENANKTIVPAALPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSAWRIMTTLNMLGGRQ
FT                   VIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQASGNLLCFAPDLII
FT                   NEQRMTLPCMYDQCKHMLFISTELQRLQVSYEEYLCMKTLLLLSSVPKEGLKSQELFDE
FT                   IRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHDVVENLLSYCFQTFLDKSMSI
FT                   EFPEMLAEIITNQIPKYSNGNIKKLLFHQK"
FT   polyA_signal    4668..4673
FT                   /note="putative"
FT   polyA_site      4686
FT                   /note="putative"
XX
SQ   Sequence 4686 BP; 1353 A; 1006 C; 1044 G; 1283 T; 0 other;
     gggcgcgcgc agcggcggcg gcggcagcgg cggcggctgc agacggggcc gcccagacga        60
     tgcgggggtg ggggacctgg cagcacgcga gtcccccccc gggctcacat taatatttgc       120
     caatggactc caaagaatcc ttagctcccc ctggtagaga cgaagtcccc agcagtttgc       180
     ttggccgggg gaggggaagc gtgatggact tgtataaaac cctgaggggt ggagctacag       240
     tcaaggtttc tgcgtcttca ccctcagtgg ctgctgcttc tcaggcagat tccaagcagc       300
     agaggattct ccttgatttt tcaaaaggct cagcaagcaa tgcacagcag cagcagcagc       360
     agcagcagcc gcagccagat ttatccaaag ccgtttcact gtccatggga ctgtatatgg       420
     gagagaccga aacaaaagtg atggggaatg acttgggcta cccacagcag ggccagcttg       480
     gcctctcctc tggggaaaca gactttcggc ttctggaaga aagcattgca aacctcaata       540
     ggtcgaccag ccgtccagag aatcccaaga gttcaacacc tgcagctggg tgtgctaccc       600
     cgacagagaa ggagtttccc cagactcact ctgatccatc ttcagaacag caaaatagaa       660
     aaagccagcc tggcaccaac ggtggcagtg tgaaattgta taccacagac caaagcacct       720
     ttgacatctt gcaggatttg gagttttctg ccgggtcccc aggtaaagag acaaacgaga       780
     gtccttggag gtcagacctg ttgatagatg aaaacttgct ttctcctttg gcgggagaag       840
     atgatccatt ccttctggaa ggggacgtga atgaggattg caagcctctt attttaccgg       900
     acactaaacc taaaattcag gatactggag atacaatctt atcaagcccc agcagtgtgg       960
     cactgcccca agtgaaaaca gagaaagatg atttcattga gctttgcacc cctggggtaa      1020
     ttaagcaaga gaaactgggc ccggtttatt gccaggcaag cttttctggg acaaatataa      1080
     ttgggaataa aatgtctgcc atttctgttc atggcgtgag tacctctgga ggacagatgt      1140
     accactatga catgaataca gcatcccttt ctcagcagca ggatcagaag cctgttttta      1200
     atgtcattcc accaattcct gttggttctg aaaactggaa taggtgccaa gggtctggag      1260
     aggacaacct gacttccttg ggggctatga acttcgcagg ccgctcagtg ttttctaatg      1320
     gatattcaag ccctggaatg agaccagatg tgagttctcc tccgtccagc tcctccacag      1380
     caacgggacc acctcccaaa ctctgcctgg tgtgctccga tgaagcttcg ggatgccatt      1440
     atggggtgct gacgtgtgga agctgtaaag tcttctttaa aagagcagtg gaaggacagc      1500
     acaattacct ttgtgctgga agaaatgatt gcatcattga taaaattcga agaaaaaact      1560
     gtccagcatg ccgctatcga aaatgtcttc aagctggaat gaacctggaa gctcgaaaaa      1620
     cgaagaaaaa aattaaagga attcagcaag ccactgcagg agtctcacaa gacacttctg      1680
     aaaacgctaa caaaacaata gttcctgccg cgctgccaca gcttacccct accctggtgt      1740
     cactgctgga ggtgatcgag cctgaggtgt tatatgcagg atatgacagc tctgttccag      1800
     actcagcatg gagaattatg accacgctca acatgttagg tgggcgccaa gtgattgccg      1860
     cagtgaaatg ggcaaaggcg ataccaggat tcagaaactt acacctggat gaccaaatga      1920
     cccttctaca gtactcatgg atgtttctca tggcatttgc cctgggttgg agatcataca      1980
     gacaagcaag tggaaacctg ctatgctttg ctcctgatct gattattaat gagcagagaa      2040
     tgactctacc ctgcatgtat gaccaatgta aacacatgct gtttatctcc actgaattac      2100
     aaagattgca ggtatcctat gaagagtatc tctgtatgaa aaccttactg cttctctcct      2160
     cagttcctaa ggaaggtctg aagagccaag agttatttga tgagattcga atgacttata      2220
     tcaaagagct aggaaaagcc attgtcaaaa gggaaggaaa ctccagtcag aattggcagc      2280
     ggttttatca actgacaaaa cttttggact ccatgcatga tgtggttgaa aatctcctta      2340
     gctactgctt ccaaacattt ttggataagt ccatgagtat tgaattccca gagatgttag      2400
     ctgaaatcat cactaatcag ataccaaaat actcaaatgg aaatatcaaa aagcttctgt      2460
     ttcatcagaa atgactgcct tactaagaaa ggctgcctta aagaaagttg aatttatagc      2520
     ttttactgta caaacttatc aacttgtctt gtagatgttt tgtcgttctt tttgtttgtc      2580
     ttgtttgttt tctatacgca ctacatgtgg tctctagagg gccaagactt ggcaacagaa      2640
     gcagatgagc catcactttt cagtgacagg aaagcagaca gtgatgtgca ttggctggtg      2700
     tatcacagaa actagaacag ttagtggaga catgtccact atcagagaag gaccgcacct      2760
     gaaccaccag tgcccaaagt ccatgtgatc aactttctgc tcaactttca gttggctgga      2820
     taacactttc tagacttttc tgttggtgta tttttcccat gtatagttag gatagcattt      2880
     tgatttatgc atggaaacct gaaaaaagtt tacacgtgta tatcagaaaa gggaagttgt      2940
     gccttttata gctattactg tctggtttta acaatttcct ttatattcag tgaactatgc      3000
     ttgctcgttt ttcttaaata atttttgtat tccagttatt gtatagctgt ttaagatggg      3060
     cagctgcctc acagctctcc tagacgctaa cattaatttc cgtgtgaaaa tgggtcggtg      3120
     ctcctaccct gatggcactc agctatcaga agaccacaga aattgactca gatctccagt      3180
     attcttgtca aaagctctta ctctgtatat atctgcttcc atggggaatt atataggttg      3240
     tgcagattaa ccgtcctaac tggtatagag cacctagtcc agtgacctgc tgggtaaact      3300
     gtggatgatg gttacaaaag actaattgta aaacagtgcc caccaacagg ccccgtttgc      3360
     acccaatgca ccatctcttc agtggtgcga tagcaacaaa gtttgtaact cagctctttc      3420
     aggaccttcg ggagtagttt gtgtaacatt ttaaaatgta ttattccaga taaccagctg      3480
     tgataaagcc gagagattgt tttaatcaga ccaagtaact tctctcatta aacgttaccc      3540
     tcaactaagt ctctaatatg gcaagaatgg ctagacaccc attttcacat cccacctgtc      3600
     accaattggt ctagctttcc tggtggtaca ggaaaatcag ctactgattt tttgttattt      3660
     agaactgaat gtcaggcatc catgtttgtc caactataca tccctacatg tgccatagaa      3720
     tctaacacaa gtcttgtgaa cttcttcaca ctgagagtta tcattttaaa caaaacagaa      3780
     gctgtagtag ccctttctgt gtgcacctta ccaactttct gtgactcaaa gcttaacaca      3840
     cttactaagc cacaagaaat ctgatttcta cttaaggtgg ccaaattatt tgtgtaatag      3900
     aaaactgaaa atctaatatt aaaaatatga aacttctaat atatttttat atttagttct      3960
     agtttcagat atatatcata ttggtattca ctaatctggg aagggaaggg ctactgcagc      4020
     tgtacatgca atttattaac atgattgtaa aatagctgta tagtgtaaaa taagaatgat      4080
     ttttagatga gattgtttta tcatgacatg ttatatattt tttgtagggg tcaaagaaat      4140
     gttgatggat atcctataag atttatagta tataagagca tccatacagg cctcagtggt      4200
     cttggaaatt aaaacaggtt tgctctaagc tagggagagg gagctgggac tggccctgtg      4260
     tgcagtgcag gtcctgaggg tttgacccga tcagatcaca ggggaactaa ttccctccca      4320
     tctaaccatc ctcatccgac catggccctg tcagtgcagg ctggctttat taaatccagg      4380
     acagaaaggt ggcgcttatg tacttagagg caccgtccag taacagggtt gttcccacat      4440
     gcagcctccg cacgggttaa cagaaacaga ggctttagaa gtttggcaat aatgtgcata      4500
     gaggttccag caatatgtaa atactaaaga atcgcatagg aagccaataa tacactaatc      4560
     ctctccatcc tacaagagtc catttccaag taagatgagg acatgtttat gttttctttg      4620
     aatgcttttt gaatgttgtt attttcagta ttttgcagaa attatttaat aaaaaaaagt      4680
     ataatc                                                                 4686
//


spacer
spacer