Dbfetch

ID   AK155171; SV 1; linear; mRNA; HTC; MUS; 2674 BP.
XX
AC   AK155171;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus NOD-derived CD11c +ve dendritic cells cDNA, RIKEN full-length
DE   enriched library, clone:F630205L24 product:MAP kinase-activated protein
DE   kinase 2, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2674
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 148624c01b7a18c7cccc684058b745d3.
DR   Ensembl-Gn; ENSMUSG00000016528; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016448; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0016431; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0016396; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0016391; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0016217; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016852; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015797; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0016189; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0016296; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0016295; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0016367; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0016320; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016888; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015583; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015859; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000016672; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0021957; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0021929; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0021901; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0021895; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0021701; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0022411; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0021230; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0021647; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0021776; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0021787; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0021878; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0021761; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0022447; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0020973; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0021286; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Dr. John Todd (Dept. of Medical Genetics
CC   Wellcome Trust Centre for Molecular Mechanisms in Disease Wellcome
CC   Trust/MRC building Addenbrookes Hospital Cambridge) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=F630205L24
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2674
FT                   /organism="Mus musculus"
FT                   /strain="NOD"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="F630205L24"
FT                   /cell_type="NOD-derived CD11c +ve dendritic cells"
FT                   /db_xref="taxon:10090"
FT   CDS             286..1446
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="MAP kinase-activated protein kinase 2
FT                   (MGD|MGI:109298 GB|BC063064, evidence: BLASTN, 99%,
FT                   match=1663)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q3U2P8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR027442"
FT                   /db_xref="MGI:MGI:109298"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U2P8"
FT                   /protein_id="BAE33092.1"
FT                   /translation="MLSGSPGQTPPAPFPSPPPPAPAQPPPPFPQFHVKSGLQIRKNAI
FT                   TDDYKVTSQVLGLGINGKVLRIFDKRTQQKFALKMLQDCPKARREVELHWRASQCPHIV
FT                   HIVDVYENLYAGRKCLLIVMECLDGGELFSRIQDRGDQAFTEREASEIMKSIGEAIQYL
FT                   HSINIAHRDVKPENLLYTSKRPNAILKLTDFGFAKETTSHNSLTTPCYTPYYVAPEVLG
FT                   PEKYDKSCDMWSLGVIMYILLCGYPPFYSNHGLAISPGMKTRIRMGQYEFPNPEWSEVS
FT                   EEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKE
FT                   EMTSALATMRVDYEQIKIKKIEDASNPLLLKRRKKARAVEDAALAH"
XX
SQ   Sequence 2674 BP; 514 A; 764 C; 671 G; 725 T; 0 other;
     gggtacttct cggcgcggcg attcctccgg ccgggccctg ccgtcccgcg ttccccggag        60
     cgcacgtctc cggggggagg gagcagggct ggtgggcgcc cgcggcgcac agcgggaccc       120
     acggggcccc gcgaccagcc gagcctggag ccgggccggg gcggggcagc cggctccagc       180
     ccggagcaaa cttcgccgcc gggcggggcg tggcggggac ccgggcccga gccggaggag       240
     ggggcggccg cggcccctgc ctctgcgcgc gagtcgccgg gcaccatgct gtcgggctct       300
     ccgggccaga ctccgccggc gcctttcccc agccctccac cgccagcccc ggcccagccg       360
     ccgccgccgt tcccccagtt ccacgtcaag tcgggcctgc agatccgaaa gaacgccatc       420
     accgacgact acaaggtcac cagccaagtg cttggcctgg gcatcaacgg gaaggtgctg       480
     cggatcttcg acaagagaac ccagcaaaaa ttcgccctaa agatgctcca ggactgtccg       540
     aaggcgcgca gagaggtgga gctgcactgg agggcctccc agtgcccaca cattgtgcac       600
     atcgtggatg tctatgagaa cctgtatgcc gggaggaagt gcctgctgat tgtcatggag       660
     tgtctcgatg gtggagagct ctttagtcga atccaggacc gaggagacca ggcattcaca       720
     gaaagagagg cgtcagagat catgaagagc atcggcgagg ccatccagta cctgcactcg       780
     atcaacattg ctcaccggga tgtcaagcct gagaacctct tatatacttc caaaaggccc       840
     aatgccattt tgaaactcac tgattttggc tttgccaagg aaaccaccag tcacaactct       900
     ttgaccactc cgtgttatac accatactat gtggctccgg aagtcctggg cccggagaag       960
     tatgacaagt cctgtgacat gtggtccttg ggtgtcatca tgtatatttt gctgtgtggg      1020
     tatcccccct tctattccaa tcacggcctt gccatctctc cgggcatgaa gactcgtatt      1080
     cgaatgggcc agtatgaatt tcctaacccg gagtggtcag aagtatcaga agaagtgaag      1140
     atgcttatcc ggaatctgct aaaaacagag cccacccaga gaatgaccat cacagaattc      1200
     atgaaccacc cctggatcat gcaatctacg aaggtccctc agactccact gcacaccagc      1260
     cgtgtcctga aggaggacaa ggaacgatgg gaggatgtca aggaggagat gaccagtgcc      1320
     ttggccacga tgcgtgttga ctatgagcag atcaagataa agaagataga agacgcatcc      1380
     aaccctctgc ttctcaagag gcggaagaaa gctcgtgctg tggaggatgc ggctctcgcc      1440
     cactgagccg ctctgtctcc cacccactgg aggacaagca ataactctac atgaatatat      1500
     tttttagaca aagagacaca agttgcccaa tgctgcctcc tgttctcttg ggctgcgtgg      1560
     cgcccagaaa tgcctccggc tttattctgc ccttggctct ggctcccccg aggtgggggc      1620
     tggaggatgt gtgaggggca aggtgctcct gagcccgttg ctcttttgca ttttatctgt      1680
     aatttggcgt agagttttta tggaacctgt cttcttgtcc ttttccccac tcctcactcc      1740
     ttccccaggt cctttcccat ctacaaaggc tgaggcttat ccacaggtgt tgtggaagtt      1800
     gttataggga aagtccctag gttgccctat ctgtctcctc tggcctccca ctgtaacgtg      1860
     gggtcctcac tggctctaga atctgggagt tccagggaga aggcagcaga gtggcagtag      1920
     gtggcccttg gagtcaatgt tcctttgcaa ttatacaacc ctgggattga ctgctgcctt      1980
     tggaaattta ttgactgtat gctaactgtg tttgaattaa tttatatcag actggaaaat      2040
     gtactgggtg ggttttaatt tatttttttc ctctgacagt gaagcatcag tgttttgaaa      2100
     tcctttactc tatagcttgc tatctgggtg gccctggcag tgtatacaat gtgttccagc      2160
     tagagctgcc ttccagtggg ctgtctctgg aaactagctg gaaatgcagc tgaggatctg      2220
     aaatttcttt tttcttttct tttcttttct ttcttttctt ttcttttctt tcttttcttt      2280
     tcttttcttt tctttctttc tttctttctt tctttctttc tttcttcttc ttcctcctcc      2340
     tcctccttct tcttctcctc ctcctcttcc tccttctctt cctcctcctt ctcttcctcc      2400
     tccttctctt cctcctcttt ctcctcctcc ttctccttct ttctccttct gcttctttct      2460
     cttcctcttc ctcctcttct attttgttct tccttccatt tccttccccc acctttttaa      2520
     ttgcactgtc ttcatagtat cacatttgcc aaaggtggca gctttggcac ttaaagccct      2580
     gagaagtgtt ttgctttcct agactgtggg gtgagcagag tgtgcctggg aatgtctgct      2640
     tcctctttgt tcagctggag acaagcaagg gtgg                                  2674
//