spacer

EBI Dbfetch

ID   AK155158; SV 1; linear; mRNA; HTC; MUS; 2619 BP.
XX
AC   AK155158;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus NOD-derived CD11c +ve dendritic cells cDNA, RIKEN full-length
DE   enriched library, clone:F630204K04 product:src homology 2 domain-containing
DE   transforming protein C1, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2619
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 4766fb4673be6aab231e38366fd9b2d6.
DR   Ensembl-Gn; ENSMUSG00000042626; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000039110; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000094378; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107417; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Dr. John Todd (Dept. of Medical Genetics
CC   Wellcome Trust Centre for Molecular Mechanisms in Disease Wellcome
CC   Trust/MRC building Addenbrookes Hospital Cambridge) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=F630204K04
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2619
FT                   /organism="Mus musculus"
FT                   /strain="NOD"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="F630204K04"
FT                   /cell_type="NOD-derived CD11c +ve dendritic cells"
FT                   /db_xref="taxon:10090"
FT   CDS             226..1965
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="src homology 2 domain-containing transforming
FT                   protein C1 (MGD|MGI:98296 GB|NM_011368, evidence: BLASTN,
FT                   99%, match=2068)"
FT                   /db_xref="GOA:P98083"
FT                   /db_xref="InterPro:IPR000980"
FT                   /db_xref="InterPro:IPR006019"
FT                   /db_xref="InterPro:IPR006020"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="MGI:MGI:98296"
FT                   /db_xref="UniProtKB/Swiss-Prot:P98083"
FT                   /protein_id="BAE33083.1"
FT                   /translation="MDLLPPKPKYNPLRNESLSSLEEGASGSTPPEELPSPSASSLGPI
FT                   LPPLPGDDSPTTLCSFFPRMSNLKLANPAGGRLGPKGEPGKAAEDGEGSAGAALRDSGL
FT                   LPLLQDMNKLSGGGGRRTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYL
FT                   VRYMGCVEVLQSMRALDFNTRTQVTREAISLVCEAVPGAKGATRRRKPCSRPLSSILGR
FT                   SNLKFAGMPITLTVSTSSLNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDP
FT                   VNQRACHILECPEGLAQDVISTIGQAFELRFKQYLRNPPKLVTPHDRMAGFDGSAWDEE
FT                   EEEPPDHQYYNDFPGKEPPLGGVVDMRLREGAARPTLPSAQMSSHLGATLPIGQHAAGD
FT                   HEVRKQMLPPPPCPGRELFDDPSYVNIQNLDKARQAGGGAGPPNPSLNGSAPRDLFDMK
FT                   PFEDALRVPPPPQSMSMAEQLQGEPWFHGKLSRREAEALLQLNGDFLVRESTTTPGQYV
FT                   LTGLQSGQPKHLLLVDPEGVVRTKDHRFESVSHLISYHMDNHLPIISAGSELCLQQPVD
FT                   RKV"
XX
SQ   Sequence 2619 BP; 541 A; 736 C; 761 G; 581 T; 0 other;
     agagaggttt cctagctggg ctgtgcaagg atgtgctctc aaactgtcta ggtctgagtt        60
     gggagagcag aggtcacttg tccttcgcct ccccaggtca tctgttatca ccgggctgcc       120
     gaggtcagac taggttaagg gcctggggat gccccctgcc tggccccctt gcctgaattg       180
     gcaggggggc cgggctgggc agcagcccct cttctcaccc cagccatgga tcttctaccc       240
     cccaagccga agtacaaccc acttcggaat gagtctctgt catcgctgga ggagggggct       300
     tcggggtcta cccctccgga ggagctacct tccccatcag cttcatccct gggacccatt       360
     ctgcctcctc tgccggggga cgatagtccg actaccctgt gttccttctt tccccggatg       420
     agcaacctga agctggccaa tcctgctggg gggcgcctgg ggcctaaagg ggagccagga       480
     aaggctgctg aagatgggga agggagtgca ggggcagccc ttcgggactc aggcctcttg       540
     cccctcctcc aggacatgaa caagctgagt ggaggcggcg ggcgcaggac tcgggtagaa       600
     gggggccagc tggggggcga ggagtggacc agacacggga gctttgtcaa taagcccaca       660
     cgaggctggc tgcatcccaa cgacaaagtc atgggacctg gggtttccta cttggttcgg       720
     tacatgggct gtgtggaggt cttacagtca atgcgagccc ttgacttcaa tacccggact       780
     caggtcacca gggaggccat cagtttggtg tgtgaagctg tgcctggtgc caaaggggcg       840
     acaaggagga gaaagccttg tagccgccca ctcagctcca tcctggggag gagtaacctg       900
     aagtttgctg gaatgccaat cactctcact gtgtctacca gcagccttaa cctcatggca       960
     gccgactgca aacagatcat tgccaaccat cacatgcaat ctatctcttt cgcgtccggt      1020
     ggggatccgg acacagctga gtatgttgcc tatgttgcca aagaccctgt gaatcagaga      1080
     gcctgccata tcctggagtg tcctgaaggg cttgctcagg atgtcatcag caccatcggg      1140
     caggcctttg agttgcgctt caaacagtat ctcaggaatc caccgaagct ggtcaccccc      1200
     catgacagga tggctggctt tgatggctca gcttgggatg aggaggaaga agagccccct      1260
     gaccatcagt actacaatga ctttccaggg aaggaacccc ctcttggtgg ggtggtagat      1320
     atgaggcttc gggaaggggc tgctcgaccc actctgccta gtgcccagat gtccagccac      1380
     ttgggagcta cactgcctat agggcagcat gctgcaggag accatgaagt ccgtaaacag      1440
     atgttgcctc cgccgccttg cccaggcaga gaactcttcg atgacccctc ctatgtcaac      1500
     atccagaatc tagacaaggc ccggcaggct gggggtgggg ctgggccccc aaatccttct      1560
     cttaatggca gtgcaccccg agaccttttt gacatgaagc cctttgaaga tgcacttcgg      1620
     gtgccacccc caccgcagtc catgtccatg gctgagcagc tgcaagggga gccctggttc      1680
     cacgggaagc tgagccggag ggaggccgag gcgctgctgc agctcaatgg tgacttcttg      1740
     gtgcgagaga gcacgaccac gcctggccag tatgtgctca ctggcctgca gagtgggcag      1800
     cccaagcact tgctgctggt ggaccctgaa ggtgtggttc ggacaaagga tcaccgcttt      1860
     gagagtgtca gtcacctgat cagctaccac atggacaatc acttgcccat catctctgcg      1920
     ggcagcgaac tgtgcctaca gcaacccgtg gatcggaaag tgtgatcctt ctcagcttct      1980
     ccaacaggat gctctccatt tccgtctccc gtattctcta acttgtggga cctctgtttt      2040
     gtgggtctgg ccttgggtgg gaactgggag caacgaggac atgggtttag tgcccacttg      2100
     agagagagaa aaagagggtt tcagtaagga gcctggggta gcatcctgcc tctggccaaa      2160
     cttcaccaaa gtattaatgt gcagagtggt cccttgtctg ggccttgcct gtgccaacct      2220
     gatgcccttc ccccccaaag ggtgggttct tataatggaa aatgccctgt gatgataggc      2280
     ccagtggagc aactgccctt tgggggaaga gaaataatta tacctctggt ttactcctgg      2340
     gtcttcaggg taccccagat cccgcataac atatcccact ccctctgctt ccccttaaac      2400
     tttgtgcctt tgactatcat aggtctgcag atacttaatg cagagttctc aggcccttca      2460
     cgtgtggaca ggggttactg ccaccttggc ttctggagcc ctgtcctatt cagcacccct      2520
     tcctgtgtct agggagaata gggacaggag tggccgctat ctgctctgcc tttcggatgt      2580
     gcagccctta agagattgcc ccaagcctga atatggtgg                             2619
//


spacer
spacer