Dbfetch

ID   AK155045; SV 1; linear; mRNA; HTC; MUS; 2357 BP.
XX
AC   AK155045;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus NOD-derived CD11c +ve dendritic cells cDNA, RIKEN full-length
DE   enriched library, clone:F630118I07 product:sortilin-related receptor, LDLR
DE   class A repeats-containing, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2357
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; fe204b66cec1bfd907951d9b65a05f9d.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Dr. John Todd (Dept. of Medical Genetics
CC   Wellcome Trust Centre for Molecular Mechanisms in Disease Wellcome
CC   Trust/MRC building Addenbrookes Hospital Cambridge) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=F630118I07
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2357
FT                   /organism="Mus musculus"
FT                   /strain="NOD"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="F630118I07"
FT                   /cell_type="NOD-derived CD11c +ve dendritic cells"
FT                   /db_xref="taxon:10090"
FT   CDS             17..>2357
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="sortilin-related receptor, LDLR class A
FT                   repeats-containing (MGD|MGI:1202296 GB|AB015790, evidence:
FT                   BLASTN, 99%, match=2341)"
FT                   /db_xref="GOA:Q3U2X9"
FT                   /db_xref="InterPro:IPR006581"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR031777"
FT                   /db_xref="InterPro:IPR031778"
FT                   /db_xref="MGI:MGI:1202296"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U2X9"
FT                   /protein_id="BAE33011.1"
FT                   /translation="MATRSSRRESRLPFLFALVALLPRGALGGGWTQRLHGGPAPLPQD
FT                   RGFFVVQGDPRDLRLGTHGDAPGASPAARKPLRTRRSAALQPQPIQVYGQVSLNDSHNQ
FT                   MVVHWAGEKSNVIVALARDSLALARPKSSDVYVSYDYGKSFSKISEKLNFGVGNNSEAV
FT                   ISQFYHSPADNKRYIFVDAYAQYLWITFDFCSTIHGFSIPFRAADLLLHSKASNLLLGF
FT                   DRSHPNKQLWKSDDFGQTWIMIQEHVKSFSWGIDPYDQPNAIYIERHEPFGFSTVLRST
FT                   DFFQSRENQEVILEEVRDFQLRDKYMFATKVVHLPGSQQQSSVQLWVSFGRKPMRAAQF
FT                   VTKHPINEYYIADAAEDQVFVCVSHSNNSTNLYISEAEGLKFSLSLENVLYYSPGGAGS
FT                   DTLVRYFANEPFADFHRVEGLQGVYIATLINGSMNEENMRSVITFDKGGTWEFLQAPAF
FT                   TGYGEKINCELSQGCSLHLAQRLSQLLNLQLRRMPILSKESAPGLIIATGSVGKNLASK
FT                   TNVYISSSAGARWREALPGPHYYTWGDHGGIIMAIAQGMETNELKYSTNEGETWKTFVF
FT                   SEKPVFVYGLLTEPGEKSTVFTIFGSNKESVHSWLILQVNATDALGVPCTENDYKLWSP
FT                   SDERGNECLLGHKTVFKRRTPHATCFNGEDFDRPVVVSNCSCTREDYECDFGFKMSEDL
FT                   SLEVCVPDPEFSGKPYSPPVPCPVGSSYRRTRGYRKISGDTCSGGDVEARLEGELVPCP
FT                   LAEENEFILYAMRKSIYRYDLASGATE"
XX
SQ   Sequence 2357 BP; 538 A; 633 C; 659 G; 527 T; 0 other;
     gagcgttcgc ccgaacatgg cgacacggag cagcaggagg gagtcgagac tccctttcct        60
     attcgccctg gtcgcgctgc taccccgcgg ggctctcggc gggggctgga cgcagagatt       120
     gcacggtggc ccggcgccct tgccccagga ccggggcttc ttcgtggtgc agggcgaccc       180
     gcgcgatctc cggctaggaa cgcacgggga tgccccgggg gcgagcccgg cggccaggaa       240
     gccactcagg acccggcgga gcgctgctct gcagccccag cctatccagg tgtatggaca       300
     ggtcagtctg aatgactccc acaatcagat ggtggtgcac tgggccggag agaaaagcaa       360
     cgtgatcgtg gcattagccc gagacagcct ggcgttggca aggcccaaga gcagtgatgt       420
     gtatgtgtct tacgactatg gaaaatcatt cagtaagatt tcagagaagc tgaactttgg       480
     cgtgggcaac aacagcgaag ctgtgatctc ccagttctac cacagccctg ctgacaacaa       540
     gaggtacatc tttgtggatg cttacgccca atacctctgg atcacatttg acttctgcag       600
     cactatccat ggcttctcca tcccattccg ggcggctgat ctcctcctcc atagcaaggc       660
     ctccaacctc ctcttgggct ttgacaggtc tcaccccaac aagcagctat ggaagtcaga       720
     tgattttggc cagacctgga tcatgattca ggaacacgtg aagtccttct cttggggaat       780
     cgacccctat gatcagccaa acgctatcta cattgagcga catgaaccct ttgggttctc       840
     cacagtgctc cgcagtacag acttcttcca gtcccgggaa aaccaggaag tgatcctgga       900
     ggaagtgaga gactttcagc ttcgcgacaa gtatatgttt gctacaaagg tggtgcatct       960
     tccgggcagc cagcagcagt catctgtcca gctctgggtc tcctttggcc ggaagcctat      1020
     gagagcagcc cagtttgtca caaagcatcc tattaatgaa tattacatcg ctgatgccgc      1080
     cgaggaccag gtgttcgtgt gtgttagcca cagtaacaac agcactaact tatacatctc      1140
     agaggcagag gggctgaagt tctccctctc cttggagaat gtgctgtatt acagcccagg      1200
     aggggccggc agtgacactc tggtgaggta ttttgcaaat gagccgtttg ccgactttca      1260
     ccgcgtggaa ggcttacaag gagtctatat tgccaccctg attaatggtt ctatgaatga      1320
     ggagaacatg aggtcggtca tcacctttga caaaggggga acctgggaat ttcttcaggc      1380
     cccagccttc acaggatatg gagagaaaat caattgtgag ctttctcagg gttgttccct      1440
     ccacctggcc cagcgcctca gtcaactgct caacctccaa cttcggagga tgcctatcct      1500
     atccaaggag tcagcccccg gtctcatcat tgctaccggc tctgtgggaa agaacttggc      1560
     cagcaagacc aatgtgtaca tctctagcag tgctggagcc aggtggagag aggctcttcc      1620
     cggacctcat tactatactt ggggtgacca tggaggcatc atcatggcga ttgcccaggg      1680
     catggagacc aacgagctga agtacagcac caatgaaggg gagacctgga agacgttcgt      1740
     cttctcggag aagcctgtgt ttgtgtatgg gcttctcaca gaacctggtg agaagagcac      1800
     cgtcttcacc atcttcggct cgaacaagga gagtgtccac agctggctta tcctgcaggt      1860
     caatgccact gatgccttgg gggttccttg cacagaaaac gactacaagc tgtggtcccc      1920
     atctgatgag cgaggaaatg agtgtttgct aggacacaag acagttttca aaaggaggac      1980
     ccctcatgcc acgtgcttta atggggaaga ctttgaccgg ccagtggttg tgtccaactg      2040
     ctcctgcacc cgggaggact acgaatgtga ctttggcttc aagatgagcg aagatctctc      2100
     cttagaggtt tgtgttccag accctgagtt ttctgggaag ccctacagcc ctcctgtgcc      2160
     ttgtcctgtg ggttcttcat acaggagaac gagaggctat cggaagattt ctggggatac      2220
     gtgcagtgga ggagacgttg aagcgcggct ggaaggggag ctggtcccct gtccccttgc      2280
     agaagagaat gagttcatcc tatacgccat gcgcaagtcc atctaccgct acgacttggc      2340
     ctcgggagcc acagagc                                                     2357
//