spacer

EBI Dbfetch

ID   AK154968; SV 1; linear; mRNA; HTC; MUS; 2293 BP.
XX
AC   AK154968;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus NOD-derived CD11c +ve dendritic cells cDNA, RIKEN full-length
DE   enriched library, clone:F630113E17 product:Lipocalin-1 interacting membrane
DE   receptor (Lipocalin-interacting protein) homolog [Homo sapiens], full
DE   insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2293
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 6fe71004a658f471921c330c933040d8.
DR   Ensembl-Gn; ENSMUSG00000022999; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000023736; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109127; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Dr. John Todd (Dept. of Medical Genetics
CC   Wellcome Trust Centre for Molecular Mechanisms in Disease Wellcome
CC   Trust/MRC building Addenbrookes Hospital Cambridge) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=F630113E17
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2293
FT                   /organism="Mus musculus"
FT                   /strain="NOD"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="F630113E17"
FT                   /cell_type="NOD-derived CD11c +ve dendritic cells"
FT                   /db_xref="taxon:10090"
FT   CDS             312..1781
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="Lipocalin-1 interacting membrane receptor
FT                   (Lipocalin-interacting protein) homolog [Homo sapiens]
FT                   (UniProt|Q969J4, evidence: FASTY, 95.1%ID, 100%length,
FT                   match=1467)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q9D1E5"
FT                   /db_xref="InterPro:IPR006876"
FT                   /db_xref="InterPro:IPR008075"
FT                   /db_xref="MGI:MGI:1289247"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9D1E5"
FT                   /protein_id="BAE32960.1"
FT                   /translation="MEAADYEVLSVREQLFHDRVRECIISILLFATLYILCHIFLTRFK
FT                   KPAEFTTVDDEDATVNKIALELCTFTLAVALGAVLLLPFSIISNEVLLSLPRNYYIQWL
FT                   NGSLIHGLWNLVFLFSNLSLVFLMPFAYFFTESEGFAGSRKGVLGRVYETVVMLILLTL
FT                   LVLGMVWVASAIVDNDKASRESLYDFWEYYLPYLYSCISFLGVLLLLVCTPLGLARMFS
FT                   VTGKLLVKPRLLEDLEEQLNCSAFEEAALTRRICNPTSCWLPLDMELLHRQVLALQAQR
FT                   VLLEKRRKASAWQRNLGYPLAMLCLLVLTGLSVLIVAVHILELLIDEAAMPRGMQDAAL
FT                   GQASFSKLGSFGAIIQVVLIFYLMVSSVVGFYSSPLFGSLRPRWHDTSMTQIIGNCVCL
FT                   LVLSSALPVFSRTLGLTRFDLLGDFGRFNWLGNFYIVFLYNAAFAGLTTLCLVKTFTAA
FT                   VRAELIRAFGLDRLPLPVSGFPRASRKKQHQ"
FT   polyA_signal    2266..2271
FT                   /note="putative"
FT   polyA_site      2293
FT                   /note="putative"
XX
SQ   Sequence 2293 BP; 416 A; 663 C; 664 G; 550 T; 0 other;
     tcctggcact tccgcgtagc cgggcggcgg gtacttgcgt tgaaacgtgc ttgcgagtga        60
     ccccacctta aaggggaggg gaccgagggg gacccgagcc ctttaagact aggcgggctg       120
     gggcctgccc ctttaagggc ggggcgtccg accgcagaat ctgagcccca gattaccttg       180
     agtttccgtc acgggcagcg aggagaggcg cttaggctgg gtccgggtgc ttggcgggcg       240
     gcggcggcct catccccgct cgtcctcccc gggcccggag acacccccgc cccagtcatg       300
     ctgagcagag tatggaagca gctgactacg aagtgctatc cgtgcgagaa cagctgttcc       360
     acgacagggt ccgcgagtgc atcatctcaa tacttctgtt tgcaacactc tacatcctct       420
     gccatatctt cctgacccgc ttcaagaagc ctgctgagtt caccacagtg gatgatgaag       480
     atgccacagt taacaagatt gcgctggagc tgtgcacctt taccctggcg gtcgccctgg       540
     gcgccgtctt actcctgccc ttctccatca tcagcaacga ggtgctgctc tcgttgccac       600
     gcaactacta catccagtgg ctcaatggct ccctcatcca tggtctgtgg aacctcgttt       660
     tcctcttctc caatctgtcc ctcgtcttcc ttatgccctt tgcatatttc ttcacagagt       720
     ctgaaggctt tgctggctcc agaaagggtg tcctgggccg ggtctacgag acagtggtga       780
     tgttgatcct cctcacgctg cttgtgctgg gcatggtgtg ggtggcatcc gccattgtag       840
     acaatgacaa ggccagcagg gagtcgctct acgacttctg ggagtactac ctcccctatc       900
     tctactcctg tatctccttc ctcggagttc tgctgcttct ggtgtgcact ccactaggtc       960
     tcgcccgcat gttctctgtc actgggaagt tgctggtcaa gccccggcta ctggaagacc      1020
     tggaggaaca gctgaactgc tcagcctttg aggaggcagc tctgactcga agaatctgca      1080
     atcccacctc ctgctggctg ccactggaca tggaactgct gcatagacag gtcctggctc      1140
     tgcaggcaca gagggtcctc ttggaaaagc gtcggaaggc gtcagcctgg caacggaacc      1200
     tgggctaccc tctggccatg ctgtgcttgc tggtgctgac gggcctgtct gtcctcatcg      1260
     tggctgtcca catcctggag ctgcttattg acgaggctgc catgccacgg ggcatgcagg      1320
     atgctgccct aggccaggcc tccttctcca aactgggatc ctttggcgcc atcatccagg      1380
     ttgtgctgat attttacctg atggtgtcct cagtggtggg tttctacagc tctccactct      1440
     ttggaagcct gaggcctagg tggcatgaca catcgatgac acagatcatt gggaactgtg      1500
     tctgcctcct ggtcctcagc tcagcacttc ctgtcttctc tagaactctt ggcctgacac      1560
     gctttgacct gctgggtgac tttggacgct tcaactggct aggcaatttc tacatcgtgt      1620
     tcctctacaa cgcagccttt gctggcctca ccacactctg tctggtgaag accttcacgg      1680
     cagctgtgag ggcagagctg atccgagcct ttgggctgga cagactgcca ctgcctgtct      1740
     ctgggtttcc ccgggcttct aggaagaagc agcatcaatg acctccagct gggggctgag      1800
     aaggagagaa ctgggcagtg cctaggcctg gcggtgagcc ccagggggct gcacctcagg      1860
     acctggaacc tgagagtagg tgacagaggg gacggaccat ctgcactgtt gcttaatctg      1920
     agccagagtt tgggacccgg ctggcctcct gccttttcag atgtagctgt ggcctgagca      1980
     tccatctggt ggagctgggg gactcgctct agttcctgga cccaaatacg tttacacatc      2040
     tatctgcctc aatcctgttc caggccatgc ctgaagccat gtttacatga tttgatgtgc      2100
     aatagggtgg gtgggacttg gggggactgg gccaggggta ggttctggag acaggtcttc      2160
     cttgcctctg gcccagaaga gccgaagcac tgtgctatcc tgtggagggc tttggaccac      2220
     tggagagacc aagggtgctg ggaggaggcg gctgcaccca cgagcaataa aattgatccc      2280
     agggttttct tgg                                                         2293
//


spacer
spacer