spacer

EBI Dbfetch

ID   AK154927; SV 1; linear; mRNA; HTC; MUS; 2607 BP.
XX
AC   AK154927;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus NOD-derived CD11c +ve dendritic cells cDNA, RIKEN full-length
DE   enriched library, clone:F630111J02 product:N-myc downstream regulated 3,
DE   full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2607
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; fd34d716c5e96bbd6f1c785bbf17c191.
DR   Ensembl-Gn; ENSMUSG00000027634; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072298; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Dr. John Todd (Dept. of Medical Genetics
CC   Wellcome Trust Centre for Molecular Mechanisms in Disease Wellcome
CC   Trust/MRC building Addenbrookes Hospital Cambridge) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=F630111J02
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2607
FT                   /organism="Mus musculus"
FT                   /strain="NOD"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="F630111J02"
FT                   /cell_type="NOD-derived CD11c +ve dendritic cells"
FT                   /db_xref="taxon:10090"
FT   CDS             126..1253
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="N-myc downstream regulated 3 (MGD|MGI:1352499
FT                   GB|AK004689, evidence: BLASTN, 100%, match=2584)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q544I1"
FT                   /db_xref="InterPro:IPR004142"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="MGI:MGI:1352499"
FT                   /db_xref="UniProtKB/TrEMBL:Q544I1"
FT                   /protein_id="BAE32930.1"
FT                   /translation="MDELQDVQLTEIKPLLNDKNGTRNFQDFDCQEHDIETPHGMVHVT
FT                   IRGLPKGNRPVILTYHDIGLNHKSCFNTFFNFEDMQEITQHFAVCHVDAPGQQEAAPSF
FT                   PTGYQYPTMDELAEMLPPVLTHLSMKSIIGIGVGAGAYILSRFALNHPELVEGLVLINI
FT                   DPCAKGWIDWAASKLSGFTTNIVDIILAHHFGQEELQANLDLIQTYRLHIAQDINQENL
FT                   QLFLGSYNGRRDLEIERPILGQNDNRLKTLKCSTLLVVGDNSPAVEAVVECNSRLDPIN
FT                   TTLLKMADCGGLPQVVQPGKLTEAFKYFLQGMGYIPSASMTRLARSRTHSTSSSIGSGE
FT                   SPFSRSVTSNQSDGTQESCESPDVLDRHQTMEVSC"
FT   polyA_signal    2582..2587
FT                   /note="putative"
FT   polyA_site      2607
FT                   /note="putative"
XX
SQ   Sequence 2607 BP; 666 A; 666 C; 609 G; 666 T; 0 other;
     gctccttgct gctgctgctg ctgctgctgc tgctgctgcc gctgctgctg tagattgacg        60
     gccccgcgct agcgcttcag agttcctggt tcatccttga gactcatctg ctctgagcca       120
     tcctcatgga tgaacttcag gatgttcaac tcacagagat caaaccgctt ctaaatgata       180
     agaatggcac acgaaacttc caggactttg actgtcagga acatgacatt gaaacaccgc       240
     atggtatggt ccacgtcacc ataagaggct taccaaaagg aaacagacct gttatcctga       300
     cataccacga cattgggctc aaccataagt cctgcttcaa cacattcttc aactttgagg       360
     atatgcaaga gatcacccag cactttgctg tctgtcacgt ggacgctcct ggccaacaag       420
     aagcagcacc ctccttcccc acagggtacc agtaccccac catggatgag ctagctgaga       480
     tgctgcctcc tgttctcaca cacttaagta tgaagagcat cattggtatt ggggttggag       540
     caggagccta cattctcagc agatttgcac tgaatcatcc agagctggtg gaaggtcttg       600
     tgctcattaa cattgacccg tgtgctaagg gctggattga ctgggcagct tccaaactct       660
     caggttttac caccaacatt gtggacataa ttctggctca tcactttggc caggaggagt       720
     tgcaggccaa tttggacctc attcaaacct acagactgca cattgctcaa gatatcaacc       780
     aagaaaacct ccagctcttc ctgggttcct ataatgggcg cagagacctg gagatcgaaa       840
     ggcctatact gggccaaaat gataacagat tgaaaacgct aaagtgttct accttactgg       900
     tggtggggga caattcacct gctgtggagg ctgtggttga atgtaattct cgcctcgacc       960
     ctataaatac aactttgcta aagatggcag actgtggagg actgccccaa gtagttcagc      1020
     ctgggaagct caccgaggcc ttcaagtact ttttgcaggg aatgggctac ataccatctg      1080
     ccagcatgac ccggctcgcc cgatcacgaa cccactccac ctcaagtagc attggctctg      1140
     gagaaagtcc ctttagcagg tctgtgacca gcaatcagtc agatggaact caagaatcct      1200
     gtgagtcccc tgatgtcctg gacagacacc agaccatgga agtgtcttgc taagcagatc      1260
     tcctcccctg gaccatgcaa gtccctctcc ttgaaatgac cactccgtaa tagaacattt      1320
     cattccgtca gctggccccc acttcctttc actcacgcat ggccacagca tctctctcta      1380
     gtagccgaga gtgtcattct ctccaccctt tctgtgtgta ccagagccac acccatgcca      1440
     ttactgtaac attccaacat ctccatctga cctgacctcc atatcttctc ttgccagcct      1500
     ttccctatgc tccctcaaat atgtatctga tgagattctt taattcccaa ctccatgtgt      1560
     gtgcgagcac gcgtgtctgt gtctgtgtgt gcatacttct gtgactttag acatgctttc      1620
     ttgtagtgct tctgcaaagg gacttttttt gaatcctcag tggcattttt ttaagggaaa      1680
     tatgcagagt ggatatctgg gtgggttggg ccacaagatt ggattttggt tccacttgga      1740
     caacaaacag tatttgcaga gtgatttcag gagagagcag gtctgaggaa tatgcaaaac      1800
     tgtagttact gtgtgggcca ttgactgcct tgaccagtag aagggataac tattacacag      1860
     ataggcaggc agggtggcag tcacctcccc tgtccacgtg gatccatccc tgccattgtg      1920
     tgagtcagag ggatagatct gaagcctgtg aatgatgtct ggtacaccac agtgttttct      1980
     ccagagaact ggcctaagct ctagattagc caagaaagct ggaaaacaga gcgccaggct      2040
     tcactctgca gagagaaagt gctctgtccc tgtagcgtct gattccactt accagacacc      2100
     cacgcatctg caggatgtct gatgcagagc ggttctccat ccctcagttc cagaaaaaat      2160
     ggagtgatat ttaaaaatgc catcgatggt ggggatctta ctggggaaga ggaaggacca      2220
     ttagcacacc atcatgatgt cagatgacaa aatggaagcc aagacacctt gaaggtgact      2280
     ttctaggaag gtcttaagca tgtaatgtcc ctttatcaga gggaagggga caaactcagg      2340
     gcagccctgt ccaggtagaa atatttttgc ccccctgtct gatgttgatg aggggtcata      2400
     ccagccaggg agaccctctg ggaggaagct gccacacaca aggactctgg aagtatccag      2460
     atgtgagccc agccagggtc ctatggttcc aaatctgaag aaaaggtttt tcacacactc      2520
     cttgctttct gctaagataa gaaaggcgtc actctgccag agtgtgactt tttacagatt      2580
     aaataaagct gtatatgtct cattgtc                                          2607
//


spacer
spacer