spacer

EBI Dbfetch

ID   AK154802; SV 1; linear; mRNA; HTC; MUS; 4740 BP.
XX
AC   AK154802;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus NOD-derived CD11c +ve dendritic cells cDNA, RIKEN full-length
DE   enriched library, clone:F630107D16 product:WAS protein family, member 2,
DE   full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4740
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; d98359eb6eb5acad3906f260cc16bcd2.
DR   Ensembl-Gn; ENSMUSG00000028868; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000084241; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105912; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Dr. John Todd (Dept. of Medical Genetics
CC   Wellcome Trust Centre for Molecular Mechanisms in Disease Wellcome
CC   Trust/MRC building Addenbrookes Hospital Cambridge) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=F630107D16
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4740
FT                   /organism="Mus musculus"
FT                   /strain="NOD"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="F630107D16"
FT                   /cell_type="NOD-derived CD11c +ve dendritic cells"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..885
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="WAS protein family, member 2 (MGD|MGI:1098641
FT                   GB|AK035717, evidence: BLASTN, 99%, match=4738)"
FT                   /note="putative"
FT                   /note="start codon is not identified"
FT                   /db_xref="GOA:Q3U3E7"
FT                   /db_xref="InterPro:IPR003124"
FT                   /db_xref="InterPro:IPR028288"
FT                   /db_xref="MGI:MGI:1098641"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U3E7"
FT                   /protein_id="BAE32839.1"
FT                   /translation="EKMKMGQEFVESKERLGPSGYSSTLVYQNGSIGSVENVDAASYPP
FT                   PPQSDSASSPSPSFSEDNLPPPPAEFSYPADNQRGSVLAGPKRTSMVSPSHPPPAPPLS
FT                   SPPGPKPGFAPPPAPPPPPPMSVPPPLPSMGFGSPGTPPPPSPPSFPPHPDFAAPPPPP
FT                   PPPAADYPMPPPPLSQPSGGAPPPPPPPPPPGPPPLPFSGADGQPAAPPPPPPSEATKP
FT                   KSSLPAVSDARSDLLSAIRQGFQLRRVEEQREQEKRDVVGNDVATILSRRIAVEYSDSE
FT                   DDSSEFDEDDWSD"
XX
SQ   Sequence 4740 BP; 984 A; 1375 C; 1210 G; 1171 T; 0 other;
     gagaagatga aaatgggaca agaatttgta gagtccaagg agaggctggg gccttctggg        60
     tattcgtcca ccttggtgta ccagaatggc agcattggct ctgttgaaaa tgtggatgcg       120
     gccagctacc caccaccacc acagtcggac tctgcctcct caccttcccc ttcattctct       180
     gaagacaact tgcctccccc gccagcagaa ttcagctacc ctgcagacaa ccaaagagga       240
     tctgtcttgg ctggacccaa aagaaccagc atggtcagcc caagccatcc acccccagct       300
     cctcctctga gctctccgcc aggtcccaag cctggcttcg ctcctccacc tgcccctcca       360
     cctccacctc ccatgagtgt gccacctcca ctaccatcga tgggattcgg gtctcctggg       420
     acccctccac ccccatcacc tccatctttc cctcctcacc ctgattttgc tgctcctcca       480
     ccacctcccc caccaccagc agctgactac ccaatgccac cacctccttt gtcccaaccg       540
     tctggaggtg ctcctccgcc tcctcctccc cctccccctc cagggccccc gcctctcccc       600
     ttcagcggtg ctgatggcca gcctgctgca ccaccaccac caccaccttc tgaggccacc       660
     aagcccaagt cttcattgcc tgctgtgagt gacgcgcgca gtgacctgct ttctgccatt       720
     cgccaaggct ttcagctgcg aagggttgaa gagcaacggg agcaagagaa gcgtgatgtg       780
     gtgggcaatg atgtggccac catcctgtcc cgtcggatcg ctgttgagta cagcgactcg       840
     gaagatgatt cttctgaatt tgatgaagac gactggtcgg attaactccg cctgctgccc       900
     acattcctct ttctagtcct cccacctgcc ttcctccata caaactaaca gtctcatggg       960
     gggaagaaag caagggacaa agaactgcaa ggggccaaag ccaaagatct atccgagtgc      1020
     ttccttcaac tgaccatatg cttcttcctc gtgtctgcct gcaggctcct gagggtccac      1080
     agctgagctg atccatcttt ccctcaagtg accgtatcta gtgacaggaa gggagaaccc      1140
     tacagtagat ccctctgctt gggtttcaac tggagatagt gccttcccct gataaccatt      1200
     ttaacccatg gccttcgtca aaaccctttc atttagctac ttcaaataat gttatccacc      1260
     tcctgtctca cagcagtggg tacagcctgt gtgggcgcag gtggtccctt ttctgtgccc      1320
     tgacaagtag actggcacac tcctgcccca cactcagcct tctgcagcag gtaggcttgc      1380
     ttctgttagc tctgcctgga tgcctttgtt ccagaaggca tcaggcctct aaagactgtc      1440
     tcacaagtga tgcccttctg gagactgagg gtgtggcctt cctcccatgc tctctctggg      1500
     tgagtgtggg gtctgggtgt cctttgcatt cccctcctca ccccaggtgc cttaagacag      1560
     cccagttcta acctgatatt catgaccaaa ctagccctga cactcaggga cctgggcctc      1620
     tgctgactgt caggagcaaa acttgaaggt gtggcaccgc aggactggaa gagagtggaa      1680
     caccttgggt cctgcctgtt cagggtactg aggccaagat gagaagtgac tctctcaagg      1740
     tcacacagat agtgatagaa caagagccca ggcttcctgt ttccaagtca cctgtgtttc      1800
     ctgggaccaa ataatgagca cctgctggag tctgggcaga gcagcctggc tcccttctac      1860
     cccagagctc ccaaatgccg gccttgcatt gggagggttc atggcctgtg cggggaggtg      1920
     gggggggggg gctctccggt gcagctttaa ctgcagccgc tctggtaagc cgctcttatt      1980
     tccccttctg tctgcagcca gtcatgtggc atgggagctg tgctggggag gcagtgtaga      2040
     gaggagctgt ggggcagcca gccttggcag gtgcagtttg cagttcactg cagctccctc      2100
     ccccttttgt ttcctcaatt taagcagagg ttgtgccagc tgtagaaact tcagtccctc      2160
     aggctggcag ccgctgcagg tacctgcctg ggggggcctg gcagccatgg agaaggctga      2220
     gaggcagaag gacacggggt cttcctgcct caccaccttg ctgtgcatga tgatgctgac      2280
     ccaccccctt tacctccctt cccagaactg atacacgggt gttattattc aggaaaaaaa      2340
     ctgagcagct ctggccagca gcaaggtttc ttctctactg ccccaactat tgtgtggcct      2400
     cttgtgctga aatctctggc ttcagagcct gaaacaaaga gaaacaggat ctgtctctac      2460
     ccagcacagc aaatggttgt agtaattgcc aaagccctca taaacccctc cggcttgagg      2520
     agagtgcaat catggctctg ctgcctgcac ttgctgggtt cctcccctct gcctcctttc      2580
     ttgaactcag aggtagggac taagcaccag gtgccagcag gccctcctgc tgtggccact      2640
     ccagagtgct ccgtgtctcc atgtgtccgt ggcctgcccc cccccaaccc cccaaatcca      2700
     gtgtctggca ccgggtttgg cagtcaactc catgctgtgc atgtttccca ccccgtgcct      2760
     tagaagctga aggtgctttt tcatcagaac cttaacatgg ctgttgatgg taccctggct      2820
     gcagcccagc gggggctgga gaggcagggg agggcagtgg tccttccaaa tagaagtcct      2880
     ggggcctggc caggccaggg tttgggccta atggttttta ctaaattact cccctcctgc      2940
     tctccgagaa aggggagcca gagccgctca ctgtggttct gttccgacct tgaaggggcg      3000
     gtattggcct ggcttctgga atggacagag tccaccagga aagactgggg gcgggaggag      3060
     ctggggaggg gccctgtctg cggaaggtag gattagatca ttagctcagt gacctcctag      3120
     ggtttcgatg tgctgtgttc tcatcctaca gctggtttgg taatgatctg caagtcccgg      3180
     agagcaacag cacagctccg cctgacgctc tcattaaaat ccatgcagcc aagctctgcg      3240
     ctttgtagca gccggccttg cagagcctcc tcagcttggg gggctgggga cccagtcagc      3300
     tgagaggtcc tctaggctct acttaggcat atgtgtaccc aaaaaaaaaa ttttttttta      3360
     agcatgcttc ttttaaaccc agagcccttt aaaataataa agaacccagt gcaggtgggt      3420
     gtgtttgtgg aatcccgtaa gcgtagaata ccaagtttag tgactattta aactgggctg      3480
     aggctggtaa gactataaag cagtggccca taaggactct taagcgtgag gccaaggagc      3540
     cacgtccctt cccagtctgc ctggcccagg ggggctgccc ccattcctgg agcccagggg      3600
     cccagcttgc aattgctagt gtcaggagtg acttgtagct ttgccttggt tgtgaaatga      3660
     tttcattcca ggggaggggg cgggggatcc cttggaggct cagagcagct ggcccaagct      3720
     gcagctcgtc tccagtggag gcttgaatgc cctcagaaac gaccctggcc aatgtcaccg      3780
     cagagccgag gcggtgttgt cagggctaat gtgaaatctc ttcccgtggc gccgatcctc      3840
     tgactctata gcgccagctt ggacagattg aggtctctgt ggctttggtg accctgctta      3900
     agcattccca ccgtgtccct gttctgcgct agcactgcct cctgctgcag cccctgactt      3960
     gacctcaggg cctggggagg gaagcaccat accagggcca ggagctccaa ctccgacgtg      4020
     tcagcctctg ggggaggggg gattaagcct tgagcttggc tggtgcccat tggacctggg      4080
     accaggtgtt acccagagag gtgcctctgc tgtgcttcct gcctccatca ctttcctagg      4140
     gcctccgtga gggctgagaa cagctctgct ctgctcctgt attattaact tgcttcagtt      4200
     aactgacttg agaaactaac caatttttac cttctgccta gaatgatgta cacataggag      4260
     agaaagctat catgttcccg aagtgccttg ttttctctga tagaaatata tttataagga      4320
     cctattccaa taggctcttg gtgtttccca tatcaagatt tctgctagct aatgcataga      4380
     gggaatactg tctaaaaata gaccctttct tcccaaaggt tgggaggtgg gacctgagca      4440
     gtggagtgaa gccacacccc acaatttttt atttattttt ttatttttag atagggtttc      4500
     aggtagatct gcaggccttg accttactat atagttgaag atggccttga cctcctgacc      4560
     cctgcctcag ccatgcctgg ctaggacagc caaattgttg ttgtttcaag tctggtttca      4620
     tttgcttccc tgccgggttt attgtgtgta ccccatttgt actcccaata acctgaagat      4680
     tccatgtaac tcttatgtac gcgcatgaat actttaaatg ccaacctttt caatcattcg      4740
//


spacer
spacer