spacer

EBI Dbfetch

ID   AK154413; SV 1; linear; mRNA; HTC; MUS; 1394 BP.
XX
AC   AK154413;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 10)
XX
DE   Mus musculus NOD-derived CD11c +ve dendritic cells cDNA, RIKEN full-length
DE   enriched library, clone:F630030A20 product:chemokine (C-C motif) receptor
DE   6, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1394
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 8907cba4b4cac45ac5393c1422c8f8bc.
DR   Ensembl-Gn; ENSMUSG00000040899; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000097418; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164411; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000166348; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167956; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000177568; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000180103; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Dr. John Todd (Dept. of Medical Genetics
CC   Wellcome Trust Centre for Molecular Mechanisms in Disease Wellcome
CC   Trust/MRC building Addenbrookes Hospital Cambridge) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=F630030A20
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1394
FT                   /organism="Mus musculus"
FT                   /strain="NOD"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="F630030A20"
FT                   /cell_type="NOD-derived CD11c +ve dendritic cells"
FT                   /db_xref="taxon:10090"
FT   CDS             966..>1394
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="chemokine (C-C motif) receptor 6 (MGD|MGI:1333797
FT                   GB|NM_009835, evidence: BLASTN, 99%, match=749)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q3U467"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000355"
FT                   /db_xref="InterPro:IPR004067"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1333797"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U467"
FT                   /protein_id="BAE32567.1"
FT                   /translation="MNSTESYFGTDDYDNTEYYSIPPDHGPCSLEEVRNFTKVFVPIAY
FT                   SLICVFGLLGNIMVVMTFAFYKKARSMTDVYLLNMAITDILFVLTLPFWAVTHATNTWV
FT                   FSDALCKLMKGTYAVNFNCGMLLLACISMDRYIAIVQAT"
XX
SQ   Sequence 1394 BP; 340 A; 387 C; 314 G; 353 T; 0 other;
     gatctcacta cccgtctctc aatgagcact gctggttgtg tctgtcaaca gaatagtcct        60
     cacattctta ggactggagc ctggataacc actgaggcag gagtacctgg ccagtctact       120
     ttggagctca gcattttctg ggggtgtgca gccctggctc actcctgaaa ctcactctgt       180
     atacgaggct ggccttgaac tcagaaatcc acctgcctct gactctcaag tgctgggatt       240
     aaaggcatgt accaccactg cctggcgctc tcaacttttt aaaggacaga gagaaacatt       300
     gagttaagaa ttcaccaaca tctttatcat caaacacaaa ttctcctaac agaaaacaga       360
     ctggctgcat ctccagggag cacagcactg ctcaggctgc atctcaggga gcacagcatc       420
     tccagggagc acagcactgc tcaggctgca tctccaggga gcacagcact gctcaggctg       480
     catctccagg gagcacagca ctgctcagat tgggtggatt atgatcagga ctctctacct       540
     cttgtggtgg cccagatacc aatctgcgac cagtgcgatt tcctagcaac aacatgtgcc       600
     attcttgtgg taacactagt ggcttgacag gctgattcat ttccaggtac tgtgagtgtc       660
     tgccattcaa gtaagcatga cagtgacctt ctctccgaga gctctgattg ccaatctcac       720
     cgtgctgaga tcagcgttct gcagagttcc agggtgctgg cccagcacat catagcattg       780
     tgcagagaca ggggcaactt acaaatcctg ggtctttcgg acttggttcg ccactctaat       840
     cagtaagact tcacctctgc tctcccaaca tctgcactag tgagagtgtg gctgaactgc       900
     ccacttccct ttctacacca gatctggctc tcccatccac atagagaacc acgcctgcct       960
     ggggaatgaa ttccacagag tcctactttg gaacggatga ttatgacaac acagagtatt      1020
     attctattcc tccagaccat gggccatgct ccctagaaga ggtcagaaac ttcaccaagg      1080
     tatttgtgcc aattgcctac tccttaatat gtgtctttgg cctcctgggc aacattatgg      1140
     tggtgatgac ctttgccttc tacaagaaag ccagatccat gactgacgtc tacctgttga      1200
     acatggccat cacagacata ctctttgtcc tcaccctacc gttctgggca gttactcatg      1260
     ccaccaacac ttgggttttc agcgatgcac tgtgtaaact gatgaaaggc acatatgcgg      1320
     tcaactttaa ctgtgggatg ctgctcctgg cctgtatcag catggaccgg tacattgcca      1380
     tcgtccaggc aacc                                                        1394
//


spacer
spacer