spacer

EBI Dbfetch

ID   AK154381; SV 1; linear; mRNA; HTC; MUS; 5432 BP.
XX
AC   AK154381;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus NOD-derived CD11c +ve dendritic cells cDNA, RIKEN full-length
DE   enriched library, clone:F630025J19 product:transforming growth factor, beta
DE   receptor I, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-5432
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; a624b013b81277a34587c699da78d3f6.
DR   Ensembl-Gn; ENSMUSG00000007613; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000007757; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Dr. John Todd (Dept. of Medical Genetics
CC   Wellcome Trust Centre for Molecular Mechanisms in Disease Wellcome
CC   Trust/MRC building Addenbrookes Hospital Cambridge) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=F630025J19
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5432
FT                   /organism="Mus musculus"
FT                   /strain="NOD"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="F630025J19"
FT                   /cell_type="NOD-derived CD11c +ve dendritic cells"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..1282
FT                   /codon_start=2
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="start codon is not identified"
FT                   /note="transforming growth factor, beta receptor I
FT                   (MGD|MGI:98728 GB|NM_009370, evidence: BLASTN, 99%,
FT                   match=5429)"
FT                   /db_xref="GOA:Q3U485"
FT                   /db_xref="InterPro:IPR000333"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR003605"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="MGI:MGI:98728"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U485"
FT                   /protein_id="BAE32548.1"
FT                   /translation="RPFVCAPSSKTGAVTTTYCCNQDHCNKIELPTTGPFSEKQSAGLG
FT                   PVELAAVIAGPVCFVCIALMLMVYICHNRTVIHHRVPNEEDPSLDRPFISEGTTLKDLI
FT                   YDMTTSGSGSGLPLLVQRTIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREER
FT                   SWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTV
FT                   EGMIKLALSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVRH
FT                   DSATDTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIARRCSI
FT                   GGIHEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWY
FT                   ANGAARLTALRIKKTLSQLSQQEGIKM"
FT   polyA_signal    5408..5413
FT                   /note="putative"
FT   polyA_site      5432
FT                   /note="putative"
XX
SQ   Sequence 5432 BP; 1493 A; 998 C; 1172 G; 1769 T; 0 other;
     caggccattt gtatgtgcac catcttcaaa aacaggggca gttactacaa catattgctg        60
     caatcaggac cactgcaata aaatagaact cccaactaca ggaccttttt cagaaaagca       120
     gtcagctggc cttggtcctg tggagctggc agctgtcatt gctggtccag tctgcttcgt       180
     ctgcattgca cttatgctga tggtctatat ctgccataac cgcactgtca ttcaccaccg       240
     tgtgccaaat gaagaggatc catcactaga tcgccctttc atttcagagg gcaccacctt       300
     aaaagattta atttatgata tgacaacatc agggtctgga tcaggtttac cactgcttgt       360
     tcaaagaaca attgccagga ccattgtgtt acaagaaagc attggcaaag gtcggtttgg       420
     agaagtttgg cgaggcaaat ggcggggaga agaagttgct gtgaagatat tctcttctag       480
     agaagagcgt tcatggttcc gagaggcaga gatttatcag actgtaatgt tacgccatga       540
     aaatatcctg ggatttatag cagcagacaa caaagacaat gggacatgga cgcagctgtg       600
     gttggtgtca gattatcatg agcatggatc ccttttcgat tacttgaata gatacactgt       660
     tactgtggaa ggaatgatca agcttgctct gtccacagca agtggtcttg cccatcttca       720
     catggagatt gttggtaccc aaggaaaacc agctattgcc catagagatt tgaaatcaaa       780
     gaatatcttg gtgaagaaaa atggaacctg ttgtattgca gacttgggac ttgctgtgag       840
     acatgattct gccacagata caattgatat tgctccaaac cacagagtag gcactaaaag       900
     gtacatggcc cctgaagttc tagatgattc cataaatatg aaacattttg aatccttcaa       960
     acgcgctgac atctatgcaa tgggcttagt gttctgggaa attgctcgac gctgttctat      1020
     tggtggaatc catgaagact atcagttgcc ttattatgat cttgtacctt ctgatccatc      1080
     ggttgaagaa atgagaaaag tagtttgcga acagaagtta aggccaaata ttccaaacag      1140
     atggcagagc tgtgaggcct tgagagtgat ggctaaaatt atgagagaat gctggtatgc      1200
     caatggagca gcaaggctga cagctttgcg aattaaaaaa acattgtcac aactcagcca      1260
     acaggaaggc atcaaaatgt aactgaaaca ccgtgggaac tctgctctct tcatatctgc      1320
     tcctgggtgt ttaggaggct ggttgttcta cctcactgag agaacagagg gctctgcttc      1380
     ctcttgcagc agtggaatat ggtcaactga aagcttccca gggtttctct gggcccagag      1440
     gcagccgtgg ggtcctttct gtgcactatg gatacttctt ccagacagtt acagaatgtt      1500
     gtgtagtcta cttttgtttt tattaacaaa gcttgttttt aaagacaact gccagccctt      1560
     agggagctgc tgtgctgttg accttctgta agggtgaagg agctggggtg tggcactaaa      1620
     tgaagcactt ctgattttca ctcctagtag tacattctca gaggactctg aaccactagt      1680
     gtttccttgg ttcactttga atgtactgtt ctataatttt tcaagatctt aaactaacac      1740
     tttaaactct atagtctaaa aaatatgacc tcgtggaggc gtgggggcac agttgctccg      1800
     ttgtatttgt gcacagctcc ttcacactct gaacacaaca caccttcaca gtagggttgt      1860
     gctacaccag taagtgctac ttttgcatct gtctaagtgg aaacgaacag aactacttaa      1920
     aggcggtgtt aagtcctgta tcattttcat tcaaaaagtt tatttttctg agtaacctaa      1980
     accttttctg ggtttgtttt tgttttttga gggtttttgt gatagatgtc attcagtctt      2040
     catgcctttc tcctacccag atgtgcttga accactgagg caaggctgta gcattgataa      2100
     gcagtgactg ccatgcggga acaccccaca ggagcactgg agctctgcag ttgagacgtt      2160
     tagcctgagt ttattttaag aagtgaagtg gcactccaaa catgtacagt gctttatgga      2220
     tgtaatcatt atggtataca gactcctttt gaaaggggag gcttgtctat tgccgaagga      2280
     aaagttgtat gctgttctgt aagccatttc tttttcttta tttgatcaaa gcagtgtttt      2340
     gttttgtttt gatttttctt ttttggaaag gaattgcatt taaaattcaa atgtggttaa      2400
     tgttaaataa taggcctttt tctaggaagg cagatatagt taatatgaat gtacaagtgt      2460
     aggtgacttt cacatgttat gtagctgtaa gtatttgtgg attctatctt gggaagggta      2520
     gagttagtgg agttttgagg tctcactacc ctttgaggaa ggcagctttt aattcagtct      2580
     ttttatctca tatgtgcaga tcttgcaact gcttgattta catggtagca atgaattcag      2640
     tgccacgttg atactaggag aagcagcaac taatagctat tctgagtaga ggctctcttc      2700
     atatattctt ggtcatatta aatgtcaaag tcagtccgtt gggtcttctc actgctgctg      2760
     gagttaggtg gttgagcctg ggttttactt cagtgctgtc aaatctttgc agggcttgtg      2820
     tggctttcaa agtccttttt atcactgtga tcatattctg ggcggggaaa tgttatcatc      2880
     attgcttgag acgagatgtt gaacatagtg ataccaatcc ccagataaaa aggtcaaaat      2940
     aacctttagt gtttagccaa gaagagattg tgactattga tctgaagcag ctgggctctg      3000
     ttaatgtctt atttcaaacc tagcatacat ttgaagacta tttggtctta aaccaaagta      3060
     actgtaggac gaatgacata ctacctagac attagtgtcc gtttcatacg tcagaaacac      3120
     catgggaaaa agtacctaga gattagtatc tttaatacaa atctgagttt tttctgtaat      3180
     tatcatgatt tcatcaatgt aagtaagggt ttgttgttac agttgtatca cctgcttaaa      3240
     taagctcttg tgctataatc aggtactttt ggggcctttg ttttcagttt tttccatttc      3300
     taacccttcg agatctgctt tatagaaatc cagggaccaa tgtattttat cactaaaact      3360
     gtttttatat aattttaaga ccataccaaa agttatctga gttaaagttg taatacgttt      3420
     cttactttct tgcaaggaaa tgggttttta ctgaagacac ttctcatgat atctgaagtt      3480
     gaagaatcat tatgtttttc ttacctaagt ggataaaatg tgctttgatg aatcagggaa      3540
     ttttttaaag ttcgaattta gttctaaatt gagtttacat gtttacagct aattttttgt      3600
     gtagggatag tttgattctc taggtggcca atactgaata taaaaataac ttaaaaattg      3660
     agataggtca tggttaatgt ggctataact atatatacat ctaattagag aaatatttct      3720
     atgtaatttt gtagtgcagt ctgttgtttc tattgccaat caaagacttc cccccagccc      3780
     caaagtgtag tatggctaag acatatcttc tgacaaatta catattatct tgtcaatacc      3840
     ctggttaagc tagcatgaag gaagtatgac ttactgaggc ttacacaact tgagtccctt      3900
     atatcttcag ctctgttttt cccactctgc ctttctgctg ccccctggct cagagactta      3960
     gtgttcctga ccccacctcc agcctttgga cctaagagct gcttttgaga cctaaaatga      4020
     agtgattgat ggaagctgtg tgacattttt ccacttcctt gagtcactgg gtgttatgag      4080
     ggagtgatct gcaaattggg gtagggggtg cccctactgg tagccctgct ttgatgtcag      4140
     ctctgggcaa agattagggt gacagctaag tggcagtgga agttggcctc agaagtagtg      4200
     gccagctgtg tctctagtag gacagtaaag gcatgaagct cagcctgtaa tcctgctact      4260
     acagtagtac tccagaagtg ccttgaggcc ctgtgtgggg ctgtggccat caagaattcc      4320
     agattttggt tctcgctgca gacttaagtg gccatgtagc catttttgta atccatacat      4380
     gtttgactct tccctctgca aattgtcaga tacgtaaaac caatgacaaa ctactactta      4440
     acatgcacac caaaatctgc ccagaagaca ttgtgatttc attccatgca ctgaaggaat      4500
     gattgtaaat catttctttg ttccttggtc atgggagtgt tctggttcta cattgtggag      4560
     attccagctg ttgttctgtt atagcccagc agaacaagtc gacgtgttga aattctgaag      4620
     aatagtttgg gagtgcagta cagcttcatg tgttggatgt tgaaactttc atgggccctc      4680
     tttagaaaag cagaggactg tcagcacatt atttttaatc ctgttatgca ctcgtactta      4740
     ttgtcagtaa caataagtac gagtattgaa aatattgtca gtaacattca gtctctttct      4800
     taaagtgaat ttgcttattt ttcaatgaga tttgtgagtt taatattatg aactgtgttt      4860
     tgataatccc tttttcacat tgtgccaatg gaatggaata tttgatattt ctttatatgt      4920
     caaggagatg cttcaatatg tcatttgctt taaacttaaa ttacctctca agagaccaag      4980
     gtacatttac ctcattgtgt atataatgtt taatatttgt cagcatccac caggtttgca      5040
     attttatttc tataaagtgt gagtgttacg ttgctaagtt actcagatgg tactgtattg      5100
     tttatatctg taccccaaat gacatcatct agactttgtt ttctgtgtct tattgtattt      5160
     gtgcagtcct ttaaccctgt tggtgtgatt gctgcccttt cagatatgtg caggtgtcta      5220
     taggaattct catttaaggt gaatggtttt gagaaacctg tgaagagaga agcataaact      5280
     gcatttcccc atcagttttt taaatgtaca ttgtatgtgt agtaatattc cagatgaatt      5340
     gtaaataaaa gctagggaga tgcttaaatt tcatcctaac actacagtag aaaatggaag      5400
     caatgcaaat aaacaacttt ttcccaccag tg                                    5432
//


spacer
spacer