spacer

EBI Dbfetch

ID   AK154349; SV 1; linear; mRNA; HTC; MUS; 1934 BP.
XX
AC   AK154349;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus NOD-derived CD11c +ve dendritic cells cDNA, RIKEN full-length
DE   enriched library, clone:F630022I01 product:chemokine (C-C motif) receptor
DE   7, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1934
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 07e3c006381d2ce40d4e775564dc6281.
DR   Ensembl-Gn; ENSMUSG00000037944; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103134; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Dr. John Todd (Dept. of Medical Genetics
CC   Wellcome Trust Centre for Molecular Mechanisms in Disease Wellcome
CC   Trust/MRC building Addenbrookes Hospital Cambridge) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=F630022I01
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1934
FT                   /organism="Mus musculus"
FT                   /strain="NOD"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="F630022I01"
FT                   /cell_type="NOD-derived CD11c +ve dendritic cells"
FT                   /db_xref="taxon:10090"
FT   CDS             81..1217
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="chemokine (C-C motif) receptor 7 (MGD|MGI:103011
FT                   GB|AK037965, evidence: BLASTN, 99%, match=1934)"
FT                   /note="putative"
FT                   /db_xref="GOA:P47774"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000355"
FT                   /db_xref="InterPro:IPR001718"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:103011"
FT                   /db_xref="UniProtKB/Swiss-Prot:P47774"
FT                   /protein_id="BAE32532.1"
FT                   /translation="MDPGKPRKNVLVVALLVIFQVCFCQDEVTDDYIGENTTVDYTLYE
FT                   SVCFKKDVRNFKAWFLPLMYSVICFVGLLGNGLVILTYIYFKRLKTMTDTYLLNLAVAD
FT                   ILFLLILPFWAYSEAKSWIFGVYLCKGIFGIYKLSFFSGMLLLLCISIDRYVAIVQAVS
FT                   AHRHRARVLLISKLSCVGIWMLALFLSIPELLYSGLQKNSGEDTLRCSLVSAQVEALIT
FT                   IQVAQMVFGFLVPMLAMSFCYLIIIRTLLQARNFERNKAIKVIIAVVVVFIVFQLPYNG
FT                   VVLAQTVANFNITNSSCETSKQLNIAYDVTYSLASVRCCVNPFLYAFIGVKFRSDLFKL
FT                   FKDLGCLSQERLRHWSSCRHVRNASVSMEAETTTTFSP"
XX
SQ   Sequence 1934 BP; 438 A; 557 C; 490 G; 449 T; 0 other;
     ggccagagag ggctagctgg agagagacaa gaaccaaaag cacagccttc ctgtgtgatt        60
     tctacagccc ccagagcacc atggacccag ggaaacccag gaaaaacgtg ctggtggtgg       120
     ctctccttgt cattttccag gtgtgcttct gccaagatga ggtcaccgat gactacatcg       180
     gcgagaatac cacggtggac tacaccctgt acgagtcggt gtgcttcaag aaggatgtgc       240
     ggaactttaa ggcctggttc ctgcctctca tgtattctgt catctgcttc gtgggcctgc       300
     tcggcaacgg gctggtgata ctgacgtaca tctatttcaa gaggctcaag accatgacgg       360
     atacctacct gctcaacctg gccgtggcag acatcctttt cctcctgatt cttcccttct       420
     gggcctacag cgaagccaag tcctggatct ttggcgtcta cctgtgtaag ggcatctttg       480
     gcatctataa gttaagcttc ttcagcggga tgctgctgct cctatgcatc agcattgacc       540
     gctacgtagc catcgtccag gccgtgtcgg ctcatcgcca ccgcgcccgc gtgcttctca       600
     tcagcaagct gtcctgtgtg ggcatctgga tgctggccct cttcctctcc atcccggagc       660
     tgctctacag cggcctccag aagaacagcg gcgaggacac gctgagatgc tcactggtca       720
     gtgcccaagt ggaggccttg atcaccatcc aagtggccca gatggttttt gggttcctag       780
     tgcctatgct ggctatgagt ttctgctacc tcattatcat ccgtaccttg ctccaggcac       840
     gcaactttga gcggaacaag gccatcaagg tgatcattgc cgtggtggta gtcttcatag       900
     tcttccagct gccctacaat ggggtggtcc tggctcagac ggtggccaac ttcaacatca       960
     ccaatagcag ctgcgaaacc agcaagcagc tcaacattgc ctatgacgtc acctacagcc      1020
     tggcctccgt ccgctgctgc gtcaaccctt tcttgtatgc cttcatcggc gtcaagttcc      1080
     gcagcgacct cttcaagctc ttcaaggact tgggctgtct cagccaggaa cggctccggc      1140
     actggtcttc ctgccggcat gtacggaacg cgtcggtgag catggaggcg gagaccacca      1200
     caaccttctc cccgtagggg gctcccctgc ccggactaca aggacctctc ccaggagcct      1260
     taatgtggtg cacacatgca cagactctcc atccaccgaa ttgctgctga gggaagagca      1320
     attctggcca gtcaggttga catgaggacc taagaaactg cttaacccca tcccacttat      1380
     aactacctca accaaagctg taaaagatat ggctgagaag ttaacactca agccaagaca      1440
     gctatcccca aaacgacagc caaaagtgaa agtgagaggc tgccacactt tccggagtga      1500
     gggatgtggg gccagtgaac accctggttg agtagtcttc ggaggcctct gaatgaacct      1560
     gcttctagct tagagagatg tcccggagat tcaaggacag agcttatctc cacacttagc      1620
     aagcaagcaa gagatgacag tctctctaaa tgctcccaca gagcacccct gcccctccct      1680
     tctgcctctc caccgccttt cctgaggtcc aggccacacc atcagcctga aggcagtccc      1740
     agctggggct ctggatggca atgacaagta gttgggtctc tatgatggga ataaaaaggt      1800
     aggggaaagg tgacagaaag gagagaaggt gaccctgctg gctgacagag gccagcaagc      1860
     tacttctttg ttctctgtca gccactgata cctttcctca tgttctgctt ttgattcata      1920
     tatcttttat gaag                                                        1934
//


spacer
spacer