spacer

EBI Dbfetch

ID   AK154300; SV 1; linear; mRNA; HTC; MUS; 1604 BP.
XX
AC   AK154300;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus NOD-derived CD11c +ve dendritic cells cDNA, RIKEN full-length
DE   enriched library, clone:F630016F21 product:opioid receptor, sigma 1, full
DE   insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1604
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; b07ecb5fc9194f80244a354d836581f6.
DR   Ensembl-Gn; ENSMUSG00000036078; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000059354; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000071561; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Dr. John Todd (Dept. of Medical Genetics
CC   Wellcome Trust Centre for Molecular Mechanisms in Disease Wellcome
CC   Trust/MRC building Addenbrookes Hospital Cambridge) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=F630016F21
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1604
FT                   /organism="Mus musculus"
FT                   /strain="NOD"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="F630016F21"
FT                   /cell_type="NOD-derived CD11c +ve dendritic cells"
FT                   /db_xref="taxon:10090"
FT   CDS             80..751
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="opioid receptor, sigma 1 (MGD|MGI:1195268
FT                   GB|BC002000, evidence: BLASTN, 100%, match=1580)"
FT                   /note="putative"
FT                   /db_xref="GOA:O55242"
FT                   /db_xref="InterPro:IPR006716"
FT                   /db_xref="InterPro:IPR028545"
FT                   /db_xref="MGI:MGI:1195268"
FT                   /db_xref="UniProtKB/Swiss-Prot:O55242"
FT                   /protein_id="BAE32499.1"
FT                   /translation="MPWAAGRRWAWITLILTIIAVLIQAAWLWLGTQNFVFSREEIAQL
FT                   ARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCILHASLSEYV
FT                   LLFGTALGSHGHSGRYWAEISDTIISGTFHQWKEGTTKSEVFYPGETVVHGPGEATALE
FT                   WGPNTWMVEYGRGVIPSTLFFALADTFFSTQDYLTLFYTLRAYARGLRLELTTYLFGQD
FT                   S"
FT   polyA_signal    1586..1591
FT                   /note="putative"
FT   polyA_site      1604
FT                   /note="putative"
XX
SQ   Sequence 1604 BP; 350 A; 452 C; 426 G; 376 T; 0 other;
     gagcggcttt tgagtcgtga acccacagcc tgtggcccta gttcggtctt acgttggtgg        60
     tgccaggctg cccgctagaa tgccgtgggc cgcgggacgg cggtgggcat ggatcaccct       120
     gattctgact attatcgcag tgctgatcca ggccgcctgg ttgtggctgg gcactcaaaa       180
     cttcgtcttc tctagagaag aaatagcgca gcttgctcga cagtatgcgg ggctggacca       240
     tgagcttgcc ttctctcggc tgatcgtgga gctgcggagg ctgcacccag gccacgtgct       300
     gccggatgag gagctgcagt gggtatttgt gaacgcgggc ggctggatgg gcgccatgtg       360
     tattctgcac gcctcgctgt ctgagtacgt gctgctcttc ggcaccgccc tgggctccca       420
     tggccattcg ggacgatact gggctgagat ttctgacacc atcatctctg gcaccttcca       480
     ccaatggaaa gagggcacca cgaaaagtga ggtcttctac ccaggagaga cagttgtaca       540
     cgggcctgga gaagcaacgg ctctggagtg gggaccaaac acgtggatgg tggagtacgg       600
     ccggggtgtt attccgtcta ccctgttctt tgcactagcc gacactttct tcagcaccca       660
     ggactacctc acactcttct atacccttcg ggcctatgcc cggggcctcc ggcttgagct       720
     taccacctac ctctttggcc aagactcctg accagccagg cctgaaggaa gatctgtgga       780
     tggacaggag cgggcaggac cacatccatc tctctactcg ctggaactca tattcagaca       840
     gcagcgtata ccatgcagat attaagtacc tgctgtatga ggaaggacat acatacttgt       900
     acatccagac acagctcttg ggaagcaaat gagacacaga gatgctaaga cttgtatgta       960
     ctgtaagatc atgcactcac atccacccag aaagggtcct ctacatatac tccagggggc      1020
     cagtcatgtt tgaacacaca tcacaagctt gactcactga ctcaggcttt cctagagcct      1080
     cctgctggca ttcagggctc tgggatcaag ggttgaggta gatgttacac actacctcac      1140
     tctgatgcct cattcctgta gtaatctctg gtgaagggaa agaggagctg cccttcggag      1200
     gtccccttca cctgcagcta tgatgccctt cccttcatcc ctttcctcac catatgcctt      1260
     atctccattc cactcccctg ctatgcaaat gcccccctgg cttgtcctcc ctgccccccc      1320
     cggcaaccag ttcagctggg aaagcagagg catgtagagg atgctaaagg gaagggaggt      1380
     cctccactac ggagaccctt gttggggtta gaatgggaaa gctggctagt gccccagggc      1440
     cagttcccaa ggagaggacc tggagaagta agccggggtc caaggagcca ccccattcca      1500
     aaagaagcct ttagtgtgtg tgtgcacacc ctatcagttt ccagacatat ctgttgcaat      1560
     ctctgtcttc ttgtctctct ctgttaataa aaacatatta aact                       1604
//


spacer
spacer