spacer

EBI Dbfetch

ID   AK154192; SV 1; linear; mRNA; HTC; MUS; 4819 BP.
XX
AC   AK154192;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus NOD-derived CD11c +ve dendritic cells cDNA, RIKEN full-length
DE   enriched library, clone:F630008C04 product:protein phosphatase 1F (PP2C
DE   domain containing), full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4819
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; cff85f05e4e4c9348bbf31eb7fb77774.
DR   Ensembl-Gn; ENSMUSG00000026181; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027373; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Dr. John Todd (Dept. of Medical Genetics
CC   Wellcome Trust Centre for Molecular Mechanisms in Disease Wellcome
CC   Trust/MRC building Addenbrookes Hospital Cambridge) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=F630008C04
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4819
FT                   /organism="Mus musculus"
FT                   /strain="NOD"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="F630008C04"
FT                   /cell_type="NOD-derived CD11c +ve dendritic cells"
FT                   /db_xref="taxon:10090"
FT   CDS             125..1483
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="protein phosphatase 1F (PP2C domain containing)
FT                   (MGD|MGI:1918464 GB|NM_176833, evidence: BLASTN, 99%,
FT                   match=4765)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q8CGA0"
FT                   /db_xref="InterPro:IPR000222"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="MGI:MGI:1918464"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CGA0"
FT                   /protein_id="BAE32429.1"
FT                   /translation="MASGAAQNSSQMACDSEIPGFLDAFLQDFPAPLSLESPLPWKVPG
FT                   TVLSQEEVEAELIELALGFLGSRNAPPSFAVAVTHEAISQLLQTDLSEFKRLPEQEEEE
FT                   EEEEEEKALVTLLDAKGLARSFFNCLWKVCSQWQKQVPLTAQAPQWQWLVSIHAIRNTR
FT                   RKMEDRHVSLPAFNHLFGLSDSVHRAYFAVFDGHGGVDAARYASVHVHTNASHQPELRT
FT                   NPAAALKEAFRLTDEMFLQKAKRERLQSGTTGVCALIAGAALHVAWLGDSQVILVQQGR
FT                   VVKLMEPHKPERQDEKARIEALGGFVSLMDCWRVNGTLAVSRAIGDVFQKPYVSGEADA
FT                   ASRELTGSEDYLLLACDGFFDVVPHHEVTGLVHGHLLRHKGNGMRIAEELVAVARDRGS
FT                   HDNITVMVVFLREPLELLEGGVQGTGDAQADVGSQDLSTGLSELEISNTSQRS"
FT   polyA_signal    4804..4809
FT                   /note="putative"
FT   polyA_site      4819
FT                   /note="putative"
XX
SQ   Sequence 4819 BP; 1107 A; 1216 C; 1345 G; 1151 T; 0 other;
     ggggaagtag gcggggctgc ccagagcagc tcgtggggag cactgcggca ggctggcaga        60
     gtgaagactt gactggagac tgtctcaccc cagcctagct gcaaaccccc ggaatgcact       120
     gggcatggcc tctggagccg cacagaacag cagccagatg gcctgtgaca gtgagatccc       180
     aggcttcctg gacgcattcc tccaagactt cccagcccca ctgagcctgg agagcccttt       240
     gccatggaag gtcccaggga cagtcctgag ccaggaagaa gtggaggctg agctgattga       300
     gctggcattg ggcttcctgg gcagcaggaa cgctccccca tcgtttgctg tggctgtgac       360
     ccacgaggca atttcccagc tgctgcagac agacctttct gaatttaaga ggttgcctga       420
     acaagaggag gaggaggaag aggaggaaga agagaaagcc ctcgtgacct tactagatgc       480
     caaaggcctg gcacggagct tcttcaactg cctttggaaa gtatgtagcc agtggcagaa       540
     gcaggtgccg ttgactgccc aggcccctca gtggcagtgg ctggtctcta tccatgccat       600
     ccggaacaca cgacgcaaga tggaggaccg acacgtgtcc cttcctgctt tcaaccatct       660
     cttcggcttg tctgactctg tgcaccgtgc ctactttgct gtgtttgatg gtcatggagg       720
     cgtggatgca gcaaggtatg cctctgtcca cgtgcatacc aatgcttctc accagccaga       780
     gctgcgcaca aaccctgcag cagctctcaa agaagccttc cggctcaccg atgagatgtt       840
     tctccagaaa gccaagcgag agcgactgca gagcggtacc acgggtgtgt gtgcactcat       900
     cgcgggagca gccctgcatg ttgcctggct tggagactcc caggtcatcc tggtacagca       960
     aggacgggta gtgaagctga tggagccgca caaaccggag cgacaggatg agaaagcacg      1020
     aattgaagcc ctgggtggct ttgtttctct catggactgt tggagagtca acgggaccct      1080
     ggcagtgtct agagccattg gggatgtctt ccagaagccc tatgtgtctg gggaggccga      1140
     tgcagcatcc agagagctaa cgggctcaga ggactacctg ttgcttgctt gtgatggttt      1200
     cttcgatgtt gtcccgcacc atgaagtcac gggtctcgtc catggccact tgctcaggca      1260
     caagggcaat gggatgcgta ttgctgagga gctggtggct gtggcccgtg accggggctc      1320
     ccatgacaac attacagtca tggtggtctt ccttagggag cccctggagc tgctagaggg      1380
     tggagtccag gggacagggg atgcccaggc agatgtagga agccaggact tgtccactgg      1440
     cctctcagaa cttgagatca gtaatacctc acagagaagc taagtggtcc aggcctccag      1500
     gccccatccg gactctccct ctgccctcgt gatcctcccc ttcaaagacc ttagatccaa      1560
     aaggtatagt gggcaggggt gcacactctc acagcattcc cttagcaccc cagcccttca      1620
     tgttgcctac cacagcctgt cctcatggct gcagaactgc agtaggcagc tagtggatct      1680
     cagaaggaaa cataggaaaa tggcctcacc gaagagcaga tggctgaggt gatcagggcc      1740
     ggacaggtct gggaacagaa accacaggca cctgctggta gcctaaccaa aaacacaggt      1800
     caggtcttgg aggaccctca cacagatcct ggaatgagat ctgcagccag gtgtccagcc      1860
     caggcttgtg gcttctcatt gtacccaagg ctgggagggt ttgttctgta ctaacacaca      1920
     agctcgcagt cctgcttgac tgctggcttc ccaaagagga gacattggtc ttgctgggag      1980
     gcacagcagg agagtgaccc actgccactg cactctaact gagtactaag gccactaggg      2040
     ctttctagac ctcgctttcc ccttgagctt cctggggagg tgaagtgagg tgtgtgtgtg      2100
     tgtgtgtgtc tttgtgtgct tagatttatt gcagggaaag gtctaatcca gaatcagtat      2160
     tcaggctttg tcatgttgta tcagtgccaa ggtgaccctc aaggtcatgt aacttaagca      2220
     aagcttagca tttattttat tcctgaaaac ttaagtattt tacttttttg tgtgttcgtg      2280
     gagacatttg cagtattaat gattttattt ttcctaaatc gggatggaaa caaacttttc      2340
     caggttatgt taataagcca cttaagtgcc ttaaacagct ttggtgtaga tgagaattgc      2400
     tgggtccgtc atggatcctg ataggcagac gtgttgaggt tctcaaagag gctgcatttg      2460
     ttgtgggaag gcacactttc agccagcact ctttctggga aagtcctttt gtgcgtctgg      2520
     gcacctcaga acttccttga agtgatgggt aaaggctgtg actatgggca cctggggtga      2580
     cactggcctc cttgtccacc ttggagtctg gctggttccc agctgagaga accttactgc      2640
     tcttggctag aagattgaca cactcaatct ctcttgaaac tctcttaagt gtgtttgcag      2700
     ttatgttgat tgagttgttg aagacagtgc ttaggtgagg aacttgggca agcccagcag      2760
     tccaccatct ttctcctgtg acttgtgtcc taacctgcta gactctgtcc tgacctgagc      2820
     agcatgaaag acctccacat ccctagagca gtgatggata cagtcaggca aggaaaccaa      2880
     gtgagggttg ggggggatac caagaataga aggactagga ggccctcaac aagggccaag      2940
     cgagtcaagg ctgctctctg cagacactgg caggtccaga gaataatggt ggcttagcag      3000
     aggctcaggg aaggatcagt aggaagaagg gtggctgtga ggtaggtccc catgaaggag      3060
     acatagttca cctgtagagt gaaagcccta gcaagacttg cagagctttg ttcattgcac      3120
     ctaagccctc tttgaaaaga agcaagggag ctcatactta ttcctctgag gcaagttcac      3180
     ttccagcagt aggagagcga gccagccaaa tgcagctggg cacccacctg tatgcttgcc      3240
     atttacccat tcccacagca gggatggaag agctggggcc atgtagttga ttccttgatc      3300
     aagtctcctg ataggaacgt gatcactcag atggctgccc acctaatagc taggtattgc      3360
     ttaacttgaa ggcctgctgc cttccggggg ggggggggtg tcagaatcca gcatcctcag      3420
     tgccatctca acacagggtg tggttgttgg tccagcctgc ctgtagcagt gaccttcata      3480
     gagggagata aattgatttt ggttttctcc catttttgct aacctgatca ttgctggtaa      3540
     gagtggaatt tgggcctcct tggtggtctg gattcatact cgcatgtaaa gatgtgccaa      3600
     atatcaaggc ctcagtgtaa agggaagccc ctttcccagg cttgtctgag tgcctccccc      3660
     acccttcccc ctgtctggca atggtctggg accaacatca ggcactgctc catcctgatc      3720
     tagtggccaa ggaagaccac attctcctac tgttgagggc tggccttgag cgagttccta      3780
     ggtacagaga actctttttt gtctggactg gagttgccag taccaagcct acaagacttg      3840
     ttggccacct cctcctcaga gtctcttccc aaaagaatcc cctagccagg ataatgggtg      3900
     gcttagtaga ggctcaggga aggaacaggg agaagggtgg ctgtgagctc aagtccccct      3960
     ctttgccacc atcacattgt gtgagcggaa ccagtcactg cacctctcag gcctcaggga      4020
     aaggcatgga gggcatgcat agcattacca ggagctgcca gagcacggga gcccatcctc      4080
     caccagcagc agagaggggt taagtattat tagtgtctat tcttaaaatt aagtgggctg      4140
     gaacagagct gagttacagg cgccagtgtc ttacacagat acaaaagctg aagccgtcag      4200
     cctgcctttg caggtacagc tgcctcccaa ccaaggcctg gaggcgttaa gaggtgggag      4260
     ggcacaagca ggctttcagg agtgttgaag caagggatct gcagcatagc tttgggcgtc      4320
     tccagaactc atggtgaggg aggcaccaac acctagaggt cttaaaagcc ctgcattcac      4380
     catgatctgt ctgcccctgc ccttttgggt tcttctgcat gcagtgcccc cctctcctga      4440
     tgctaagttt tggcatgggt gtcctggcta cctcaactgt attctcaagg ccaggaggat      4500
     ggctctggcc atacttacgg aagccaggcc aatttgtgtg aagcaagctg ggcttctggt      4560
     ttgattcagc ttctgtagcc tccagggacc atcctctgga gtcttgtgct ttcactggac      4620
     tcttcagctt caccaaacac accaagcttt gccatttaca tgccatgtgg gccttgccaa      4680
     gggttatttc aggggtcttc ctgggagtct tgttctaaga caccgtgttt ctttagtctt      4740
     agggacaact cccaaggtga tgagctcata ggacgtcttc ccatggggcc ctgtactggt      4800
     gtcaataaac catatattc                                                   4819
//


spacer
spacer