spacer

EBI Dbfetch

ID   AK154106; SV 1; linear; mRNA; HTC; MUS; 4832 BP.
XX
AC   AK154106;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus NOD-derived CD11c +ve dendritic cells cDNA, RIKEN full-length
DE   enriched library, clone:F630002D04 product:phosphatidylinositol 3-kinase,
DE   catalytic, beta polypeptide, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4832
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 676ffe27963f737f838fb5f1e71649ca.
DR   Ensembl-Gn; ENSMUSG00000032462; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035037; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by Dr. John Todd (Dept. of Medical Genetics
CC   Wellcome Trust Centre for Molecular Mechanisms in Disease Wellcome
CC   Trust/MRC building Addenbrookes Hospital Cambridge) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=F630002D04
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4832
FT                   /organism="Mus musculus"
FT                   /strain="NOD"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="F630002D04"
FT                   /cell_type="NOD-derived CD11c +ve dendritic cells"
FT                   /db_xref="taxon:10090"
FT   CDS             334..3528
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="phosphatidylinositol 3-kinase, catalytic, beta
FT                   polypeptide (MGD|MGI:1922019 GB|NM_029094, evidence:
FT                   BLASTN, 99%, match=4732)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q8BTI9"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000341"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR001263"
FT                   /db_xref="InterPro:IPR002420"
FT                   /db_xref="InterPro:IPR003113"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015433"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="MGI:MGI:1922019"
FT                   /db_xref="PDB:2Y3A"
FT                   /db_xref="PDB:4BFR"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8BTI9"
FT                   /protein_id="BAE32380.1"
FT                   /translation="MPPAMADNLDIWAVDSQIASDGAISVDFLLPTGIYIQLEVPREAT
FT                   ISYIKQMLWKQVHNYPMFNLLMDIDSYMFACVNQTAVYEELEDETRRLCDVRPFLPVLK
FT                   LVTRSCDPAEKLDSKIGVLIGKGLHEFDALKDPEVNEFRRKMRKFSEAKIQSLVGLSWI
FT                   DWLKHTYPPEHEPSVLENLEDKLYGGKLVVAVHFENSQDVFSFQVSPNLNPIKINELAI
FT                   QKRLTIRGKEDEASPCDYVLQVSGRVEYVFGDHPLIQFQYIRNCVMNRTLPHFILVECC
FT                   KIKKMYEQEMIAIEAAINRNSSNLPLPLPPKKTRVISHIWDNNNPFQITLVKGNKLNTE
FT                   ETVKVHVRAGLFHGTELLCKTVVSSEISGKNDHIWNEQLEFDINICDLPRMARLCFAVY
FT                   AVLDKVKTKKSTKTINPSKYQTIRKAGKVHYPVAWVNTMVFDFKGQLRSGDVILHSWSS
FT                   FPDELEEMLNPMGTVQTNPYAENATALHITFPENKKQPCYYPPFDKIIEKAAELASGDS
FT                   ANVSSRGGKKFLAVLKEILDRDPLSQLCENEMDLIWTLRQDCRENFPQSLPKLLLSIKW
FT                   NKLEDVAQLQALLQIWPKLPPREALELLDFNYPDQYVREYAVGCLRQMSDEELSQYLLQ
FT                   LVQVLKYEPFLDCALSRFLLERALDNRRIGQFLFWHLRSEVHTPAVSVQFGVILEAYCR
FT                   GSVGHMKVLSKQVEALNKLKTLNSLIKLNAVKLSRAKGKEAMHTCLKQSAYREALSDLQ
FT                   SPLNPCVILSELYVEKCKYMDSKMKPLWLVYSSRAFGEDSVGVIFKNGDDLRQDMLTLQ
FT                   MLRLMDLLWKEAGLDLRMLPYGCLATGDRSGLIEVVSTSETIADIQLNSSNVAATAAFN
FT                   KDALLNWLKEYNSGDDLDRAIEEFTLSCAGYCVASYVLGIGDRHSDNIMVKKTGQLFHI
FT                   DFGHILGNFKSKFGIKRERVPFILTYDFIHVIQQGKTGNTEKFGRFRQCCEDAYLILRR
FT                   HGNLFITLFALMLTAGLPELTSVKDIQYLKDSLALGKSEEEALKQFKQKFDEALRESWT
FT                   TKVNWMAHTVRKDYRS"
FT   polyA_signal    4811..4816
FT                   /note="putative"
FT   polyA_site      4832
FT                   /note="putative"
XX
SQ   Sequence 4832 BP; 1307 A; 1043 C; 1170 G; 1312 T; 0 other;
     ggcgtgctcc gtcgggcggt gcagcggctg cgacggagcc ggccatggtc gtgggcggtg        60
     ggcgggtgtc gcgctgagcc ccgaaggcag caagagactg ggagcggggc atgcgggtgt       120
     cggagccagg cgggcacggc tgcgggagct gctgacggcg ctgcgggatc gggagccggt       180
     ggcggcgcgc ggggcagttc atcttctaag ctgaaaaagt cttccatgaa taattcacat       240
     ttaaaaataa gttacatcat atattcctag aagactgaaa tgggggctgt tattttgagg       300
     gccctgaggt tatgagtgtg cttccgccct atcatgcctc ctgctatggc agacaacctt       360
     gacatctggg cagtggactc acagattgca tccgatggcg ccatatccgt cgatttcctt       420
     ctgcccaccg ggatttatat ccagttggaa gtacctcggg aagctaccat ttcttatatt       480
     aaacagatgt tatggaagca agttcacaac tacccgatgt ttaacctcct catggacatt       540
     gactcgtata tgtttgcatg tgtgaatcaa actgctgtat atgaggaact ggaagacgaa       600
     acacgaagac tttgtgatgt cagacctttt cttccagttc tcaaactagt gactagaagc       660
     tgtgaccccg cagaaaaatt ggactcaaaa attggagttc ttataggaaa aggtcttcat       720
     gagtttgatg ccttgaagga tcccgaagtg aatgaattta gaagaaaaat gcgcaaattc       780
     agtgaggcca agattcagtc tctggtaggg ttgtcttgga tcgactggct aaagcacacg       840
     tatccgcctg agcacgagcc gtccgtcctg gagaacttgg aagataaact ttatggagga       900
     aagctggttg tggctgtgca ctttgaaaat agccaggatg tatttagttt tcaagtgtct       960
     cccaatttga atcctataaa aataaatgaa ttggcaatcc agaaacgcct cactattcgt      1020
     ggaaaggaag atgaagctag cccctgtgac tatgtgttac aggtcagtgg gagagtggag      1080
     tatgtgtttg gcgatcatcc actaattcag ttccagtaca tccggaattg tgtgatgaat      1140
     agaaccctgc cccacttcat ccttgtggaa tgttgtaaga tcaagaaaat gtatgaacaa      1200
     gaaatgattg ccatagaggc tgccatcaac cgaaactcat ccaaccttcc tctcccttta      1260
     ccaccaaaga aaacgcgagt tatttctcat atctgggaca acaacaaccc tttccaaatt      1320
     accttggtta aaggaaataa gcttaataca gaagaaactg tgaaagttca tgtccgagct      1380
     gggctttttc acggaaccga gctcctgtgt aaaaccgtcg taagctcaga gatatcagga      1440
     aagaacgacc atatttggaa tgaacaactg gaatttgata ttaatatttg tgacttacca      1500
     agaatggctc gattatgttt tgctgtttat gcagttttgg ataaagtaaa aacgaagaaa      1560
     tcaacaaaga ctattaatcc ctctaagtat cagaccatca ggaaagccgg gaaagtgcat      1620
     tatcctgtcg catgggtaaa taccatggtt tttgacttca aaggacagct gaggtctgga      1680
     gacgtcatat tgcatagctg gtcttcgttt cctgatgagc tggaagaaat gctgaatccc      1740
     atggggactg tgcagacgaa cccatatgct gagaacgcca ccgccttgca cattacgttc      1800
     ccagagaata agaagcagcc gtgttattat ccccccttcg ataagatcat tgagaaggca      1860
     gctgagcttg ccagcggaga cagtgctaat gtgtcaagtc gtggtggaaa aaaatttctt      1920
     gctgtgctga aagaaatctt ggacagggac cccctgtctc agctgtgtga gaacgaaatg      1980
     gaccttattt ggactctacg gcaagactgc cgagaaaatt tccctcagtc actgccaaaa      2040
     ctactcttgt caatcaagtg gaataaactt gaagatgttg ctcagcttca ggcgctcctg      2100
     cagatatggc ccaaactgcc ccccagggaa gccctggaac tcctggattt caactatcca      2160
     gaccagtatg tccgggaata cgctgtaggc tgccttcgac agatgagtga tgaagaactc      2220
     tctcagtatc ttttacaatt ggtgcaagtt ttgaaatatg agccttttct cgattgtgcc      2280
     ctctccagat tcctattaga aagagcactt gataatcgga ggattgggca gtttctgttt      2340
     tggcatctta ggtcagaggt gcacactcct gctgtgtccg tacagtttgg tgtcatcctg      2400
     gaagcatact gtcgaggaag cgtggggcac atgaaagtgc tttccaaaca ggtggaagca      2460
     ctcaataagt taaaaacttt aaatagctta atcaaactga atgcggtgaa gctgagcaga      2520
     gctaagggaa aggaggccat gcacacgtgc ctgaaacaga gtgcttaccg ggaggcgctc      2580
     tctgacctgc agtcgccgct gaacccctgc gtcatcctct cagagctcta tgttgaaaag      2640
     tgcaaataca tggactccaa gatgaagccc ctgtggctgg tctacagcag cagagccttt      2700
     ggagaggact cggttggagt gatctttaaa aatggtgacg atttgcggca ggacatgctg      2760
     acgctgcaga tgctgcgcct gatggatctg ctttggaaag aagctggctt ggacctgcgg      2820
     atgctcccct atggctgctt agcaacagga gatcgctctg gcctcattga ggttgtgagc      2880
     acctctgaga caatcgctga cattcagctg aacagtagta acgtggctgc cacggcagcc      2940
     ttcaacaaag acgcactcct gaactggctc aaggagtaca actctgggga tgacctggac      3000
     cgagcgattg aggagtttac cttgtcctgt gctggctact gtgtagcctc ttatgtcctc      3060
     ggcattggtg acaggcacag tgacaacatc atggtgaaga aaaccggcca gctcttccac      3120
     atagattttg ggcatattct tggaaatttc aaatctaaat ttggcattaa aagggagcga      3180
     gtacctttta ttcttactta tgacttcatt catgtcattc aacaaggaaa aacgggaaac      3240
     actgaaaaat ttggcagatt ccgccagtgc tgtgaagatg cgtatctgat tttacggcgg      3300
     catgggaatc tcttcatcac cctgtttgcc ctgatgttga ctgcagggct gcctgagctc      3360
     acatcggtca aagatataca gtatcttaag gactcgcttg ccttagggaa gagcgaggag      3420
     gaagcactga agcagttcaa gcagaagttt gacgaggccc tcagggaaag ctggactact      3480
     aaagtgaact ggatggctca cacagtacgg aaagactaca ggtcctagcg tccgccctac      3540
     tctgccgcac ttgcctgttc gtttcctttc cattttgcac ttgcactatt gaacatgacc      3600
     ctgccagaaa tgcaaaggga atgaaatcct gaagctcaga gtgaagttca aaccacggcg      3660
     tcccgcagag cctagtctga accaccccat gcccaccctg tgttcccgag cgcttccagg      3720
     actcatcgtg agcagcagca tggaggcccc ttcctgctga ccttgcacgc gagggatgct      3780
     actagggact gctggggatc ttttctttct ttccttcagt atttggtact ttaccagaga      3840
     ggtgtacata cttcttttca gtgttgtgac caagtgctgc gactcagcca acaacttacc      3900
     acattcgggg ctgggagctg ttctaagaaa gggacctccc tctccttttt aaattggtga      3960
     gccacaaatt acattgatta tgttgaactt attattcttc aaagaaaata ttttaaacct      4020
     gtgaaaactc actaattttg ttaatattta tcatgatggc atcatttcag ccagactcgc      4080
     tgagaatcta ttggtggggc aaatataata tatatataat atatatatat atatatgctg      4140
     catatatatt tataaaattt ctagtgggag ttctatataa aaagatgttt ctttggtatt      4200
     cttcagcctg tgttttcaag ttttacagaa gcagagcttt tccctaagtt cctcttcggt      4260
     tcactgtaga tccagttctt ccagccgctt cagcactgag gcgccatgaa tgcggtttct      4320
     ctgtgtagct ctgagagttc gtttcataga acacaacact tgagcagatg catccaagga      4380
     ggcgagcaaa tgaaaaggaa tctatttatg gaataaactc gaaacctaaa tttcagtatt      4440
     ttagtaatat gccagctgtt cttaatgtat ttattaaaat gtataacaat gtgatttttc      4500
     aatggtatta gttcaaattg acgtggattc atgccacatg gaaatcttta atttatttgt      4560
     tgaggtacca tatagccagg gtgctaggtg atgagtggtg ttagcatgtg caataggaac      4620
     tactggtttg ctgtgtaaat ggatgtcagg atccagcaaa actactgctt tcttctccaa      4680
     agacatgtgg gagccttcaa tcctcagtgg catgggaaac agctgagtac ttgccccgtg      4740
     acttcagttt tctataggaa ttttattaaa gagtgtttaa ttttgttgtc cttcttaatg      4800
     ttctcagtca aataaatggg tggtttcatc tg                                    4832
//


spacer
spacer