spacer

EBI Dbfetch

ID   AK153803; SV 1; linear; mRNA; HTC; MUS; 2743 BP.
XX
AC   AK153803;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus 3 days neonate thymus cDNA, RIKEN full-length enriched
DE   library, clone:A630098I22 product:TAR DNA binding protein, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2743
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 4cd865a547d8bae5aec0133f2b058fad.
DR   Ensembl-Gn; ENSMUSG00000041459; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000084125; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=A630098I22
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2743
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="3 days neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="A630098I22"
FT                   /tissue_type="thymus"
FT                   /db_xref="taxon:10090"
FT   CDS             105..1349
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="TAR DNA binding protein (MGD|MGI:2387629
FT                   GB|BC031126, evidence: BLASTN, 99%, match=2702)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q921F2"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="MGI:MGI:2387629"
FT                   /db_xref="PDB:3D2W"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q921F2"
FT                   /protein_id="BAE32189.1"
FT                   /translation="MSEYIRVKEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRN
FT                   PVSQCMRGVRLVEGILHAPDAGWGNLVYVXNYPKDNKRKMDETDASSAVKGKRAVQKTS
FT                   DLIVLGLPWKTTEQDLKDYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMS
FT                   QRHMIDGRWCDCKLPNSKQSPDEPLRSRKVFVGRCTEDMTAEELQQFFCQYGEVVDVFI
FT                   PKPFRAFAFVTFADDKVAQSLCGEDLIIKGISVHISNAEPKHNSNRQLERSGRFGGNPG
FT                   GFGNQGGFGNSRGGGAGLGNNQGGNMGGGMNFGAFSINPAMMAAAQAALQSSWGMMGML
FT                   ASQQNQSGPSGNNQSQGSMQREPNQAFGSGNNSYSGSNSGAPLGWGSASNAGSGSGFNG
FT                   GFGSSMDSKSSGWGM"
XX
SQ   Sequence 2743 BP; 722 A; 471 C; 724 G; 825 T; 1 other;
     attttgtggg cacggagcgg cagcgcgggt gttggcggat tccttcccgt ctgggcttcc        60
     tgcttgtgct tcctagcagt ggcctagcgg agatttaagc aaagatgtct gaatatattc       120
     gggtaaaaga agatgagaac gatgaaccca ttgaaatacc atcagaagac gatgggacgg       180
     tgttgctgtc cacagttaca gcccagtttc caggggcatg cggcctgcgc taccggaatc       240
     ccgtgtctca gtgtatgaga ggagtccgac tggtggaagg aattctgcat gccccagatg       300
     ctggctgggg caatctggta tatgttgnca actatcccaa agataacaaa aggaaaatgg       360
     atgagacaga tgcttcctct gcagtgaaag ggaaaagagc agtccagaaa acatctgacc       420
     tcatagtgtt gggtctcccc tggaaaacaa ctgagcagga tctgaaagac tatttcagta       480
     cttttggaga ggttcttatg gttcaggtca agaaagatct taaaactggt cactcgaaag       540
     ggtttggctt tgttcgattt acagaatatg aaacccaagt gaaagtaatg tcacaacgac       600
     atatgataga tgggcgatgg tgtgactgta aacttcccaa ctctaagcaa agcccagacg       660
     agcctttgag aagcagaaag gtgtttgttg gacgttgtac agaggacatg actgctgaag       720
     agcttcagca gtttttctgt cagtatggag aagtggtaga tgtcttcatt cccaaaccat       780
     tcagagcttt tgccttcgtc acctttgcag atgataaggt tgcccagtct ctttgtggag       840
     aggatttgat cattaaagga atcagcgtgc atatatccaa tgctgaacct aagcataata       900
     gcaatagaca gttagaaaga agtggaagat ttggtggtaa tccaggtggc tttgggaatc       960
     agggtgggtt tggtaacagt agagggggtg gagctggctt gggaaataac cagggtggta      1020
     atatgggtgg agggatgaac tttggtgctt ttagcattaa cccagcgatg atggctgcgg      1080
     ctcaggcagc gttgcagagc agttggggta tgatgggcat gttagccagc cagcagaacc      1140
     agtcgggccc atctgggaat aaccaaagcc agggcagcat gcagagggaa ccaaatcagg      1200
     cttttggttc tggaaataat tcctacagtg gttctaattc tggtgccccc cttggttggg      1260
     ggtcagcatc aaatgcagga tcgggcagtg gttttaatgg gggctttggc tcgagcatgg      1320
     attctaagtc ttctggctgg ggaatgtagg tggtgggggg tggttagtag gttggttatt      1380
     aggttaggta gatttagaat ggtgggattc aaatttttct aaactcatgg taagtatatt      1440
     gtaaaataca tatgtactaa aattttcaga ttggtttgtt cagtgtggag tatattcagc      1500
     agtatttttg acatttttct ttagaaaaaa agaggggaaa gctaaatgaa ttttataagt      1560
     tttgttatat aaagggttaa aatactgagt gggtgaaagt gaactgctgt ttgcctaatt      1620
     ggtaaaccaa cactacaatt gatctcagaa ggtttctctg taatattcta tcattgaaat      1680
     tgttaatgaa ttctttgcat gttcagagta gaaaccattg gttagaacta cattcttttc      1740
     tccttatttt aatttgaatc ccaccctatg aattttttcc ttaggaaaat ctccatttgg      1800
     gagatcatga tgtcatggtg tttgattctt ttggttttgt ttttaacact tgtcttcctt      1860
     catatacgaa agtacaatat gaagccttca tttaatctct gcagttcatc tcatttcaaa      1920
     tgtttatgga agaagcactt cattgaaagt agtgctgtaa atattctgcc ataggaatac      1980
     ttctgtctac atgctttctc atccaagaat tcgtcatcac gctgcacagg ctgcgtcttt      2040
     gacggtgggt gttccatttt tatccgctac tctttatttc atggagtcgt atcaacgcta      2100
     tgaacgcaag gctgtgatat ggaaccagaa ggctgtttga acttttgaaa ccttgtgtgg      2160
     gattgatggt ggtgccgagg catgaaaggc tagtatgagc gagaaaagga gagcgcgtgc      2220
     agagacttgg tggtggaaaa tggatatttt ttaacttgga gagatgtgtc actcaatcct      2280
     gtggctttgg tgagagagtg tgcagagagc aatgatagca aataacgtac gaatgtttta      2340
     catcaaagga catccacatc agttggaaga ctttgagttt tgttcttagg aaacccactt      2400
     tagttgaatg tgttaagtga aatacttgta cttccctccc cctctgtcaa ctgctgtgaa      2460
     tgctgtatgg tgtgtgttct cctctgttac tgatctggaa gtgtgggaac gtgaactgaa      2520
     gctgatgggc tgcgaacatg gactgagctt gtggtgtgct ttgcaggaga acttggaagc      2580
     agagttcacc agtgagctca ggtgtctcaa agaagggtgg aagttctcat gtctgttagc      2640
     tattcataag aatgctgttt gctgcagttc tgtgtcctgt gcttggatgc ttttttataa      2700
     gagttgtcat tgtttcgttg tatgctatgg atttcctagc ccc                        2743
//


spacer
spacer