spacer

EBI Dbfetch

ID   AK153222; SV 1; linear; mRNA; HTC; MUS; 1704 BP.
XX
AC   AK153222;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus bone marrow macrophage cDNA, RIKEN full-length enriched
DE   library, clone:I830128C06 product:adipose differentiation related protein,
DE   full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1704
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 28051f7001627c0fd32322197662e63b.
DR   Ensembl-Gn; ENSMUSG00000028494; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000000466; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by David A. Hume ( Depts. of Biochemistry
CC   and Microbiology/Parasitology Institute for Molecular Bioscience
CC   University of Queensland Brisbane,Q 4072 Australia ) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=I830128C06
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1704
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="I830128C06"
FT                   /cell_type="macrophage"
FT                   /tissue_type="bone marrow"
FT                   /db_xref="taxon:10090"
FT   CDS             100..1377
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="adipose differentiation related protein
FT                   (MGD|MGI:87920 GB|NM_007408, evidence: BLASTN, 99%,
FT                   match=1681)"
FT                   /note="putative"
FT                   /db_xref="GOA:P43883"
FT                   /db_xref="InterPro:IPR004279"
FT                   /db_xref="MGI:MGI:87920"
FT                   /db_xref="UniProtKB/Swiss-Prot:P43883"
FT                   /protein_id="BAE31815.1"
FT                   /translation="MAAAVVDPQQSVVMRVANLPLVSSTYDLVSSAYVSTKDQYPYLRS
FT                   VCEMAEKGVKTVTSAAMTSALPIIQKLEPQIAVANTYACKGLDRMEERLPILNQPTSEI
FT                   VASARGAVTGAKDVVTTTMAGAKDSVASTVSGVVDKTKGAVTGSVERTKSVVNGSINTV
FT                   LGMVQFMNSGVDNAITKSELLVDQYFPLTQEELEMEAKKVEGFDMVQKPSNYERLESLS
FT                   TKLCSRAYHQALSRVKEAKQKSQETISQLHSTVHLIEFARKNMHSANQKIQGAQDKLYV
FT                   SWVEWKRSIGYDDTDESHCVEHIESRTLAIARNLTQQLQTTCQTVLVNAQGLPQNIQDQ
FT                   AKHLGVMAGDIYSVFRNAASFKEVSDGVLTSSKGQLQKMKESLDEVMDYFVNNTPLNWL
FT                   VGPFYPQSTEVNKASLKVQQSEVKAQ"
FT   polyA_signal    1685..1690
FT                   /note="putative"
FT   polyA_site      1704
FT                   /note="putative"
XX
SQ   Sequence 1704 BP; 420 A; 422 C; 467 G; 395 T; 0 other;
     ggtcgttctg gccgctttgc tgtgtggtga tctggaccgt gcggacttgc tcgtccctca        60
     gctctcctgt taggcgtctc ttttctccag gaggaaaaaa tggcagcagc agtagtggat       120
     ccgcaacaga gcgtggtgat gagagtggcc aacctgccct tggtgagctc tacctacgac       180
     cttgtgtcct ccgcttatgt cagtacaaag gatcagtacc cgtatttgag atccgtgtgt       240
     gagatggccg agaagggcgt gaagaccgtg acctctgcgg ccatgacaag tgccctgccc       300
     atcatccaga agctggagcc acaaattgcg gttgccaata cctatgcctg caaggggcta       360
     gacaggatgg aggaaagact gcctattctg aaccagccaa cgtccgagat tgttgccagt       420
     gccagaggtg ccgtaactgg ggcgaaggat gtggtgacga ctaccatggc tggagccaag       480
     gattctgtag ccagcacagt ctcaggggtg gtggataaga ccaaaggagc agtgactggc       540
     agcgtggaaa ggaccaagtc tgtggtcaat ggcagcatca atacagtttt ggggatggtg       600
     cagttcatga acagtggagt agataatgcc atcaccaagt cggagctgct ggtagaccag       660
     tacttccctc tcactcagga ggagctggag atggaagcaa aaaaggtgga aggatttgat       720
     atggttcaga agccgagcaa ctatgaacgg ctggagtccc tgtctaccaa gctctgctct       780
     cgggcttatc accaggctct cagcagggtt aaagaggcca aacaaaagag ccaggagacc       840
     atttctcagc tccactccac tgtccacctg attgaattcg ccaggaagaa tatgcacagt       900
     gccaaccaga aaattcaggg tgctcaggat aagctctatg tctcgtgggt ggagtggaag       960
     agaagcatcg gctacgacga caccgatgag tcccactgtg ttgagcacat cgagtcacgt      1020
     actctggcta tcgcccgcaa cctgacccag cagctccaga ctacatgcca gactgtcctg      1080
     gtcaacgccc aagggttacc acagaacatt caagatcagg ccaaacactt gggggtgatg      1140
     gcaggcgaca tctactccgt attccgcaat gctgcctcct ttaaggaagt gtccgatggc      1200
     gtcctcacat ctagcaaggg gcagctgcag aaaatgaagg aatccttaga tgaagttatg      1260
     gattactttg ttaacaacac gcctctcaac tggctggtag gtccctttta tcctcagtct      1320
     accgaggtga acaaggccag cctgaaggtc cagcagtctg aggtcaaagc tcagtaaacc      1380
     cctccttgtc accagagcat gatgttgctg gccagatgac cccttttgct gtattgaaat      1440
     taacttggta gatggcttta gcttagaaaa gcagcttctt agaaccaagg gcctcattat      1500
     ggtcactcac agctcagtta tggtcttgcc ccagctggcc ctggcacagg agttctctta      1560
     cctggctggt gagtggcctg tgttagtctt gtgaggacct cgaggaacct aaaagctcag      1620
     atgcacttac agtcttgtct gtggcctttg tattgttatt ggctgtaaac gtctgtctgg      1680
     accgaataaa gattcattca cgtg                                             1704
//


spacer
spacer