spacer

EBI Dbfetch

ID   AK153201; SV 1; linear; mRNA; HTC; MUS; 831 BP.
XX
AC   AK153201;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus bone marrow macrophage cDNA, RIKEN full-length enriched
DE   library, clone:I830127E03 product:adenine phosphoribosyl transferase, full
DE   insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-831
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; ba4d4114b4c84eae895276b0267f5f18.
DR   Ensembl-Gn; ENSMUSG00000006589; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000006764; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by David A. Hume ( Depts. of Biochemistry
CC   and Microbiology/Parasitology Institute for Molecular Bioscience
CC   University of Queensland Brisbane,Q 4072 Australia ) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=I830127E03
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..831
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="I830127E03"
FT                   /cell_type="macrophage"
FT                   /tissue_type="bone marrow"
FT                   /db_xref="taxon:10090"
FT   CDS             41..583
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="adenine phosphoribosyl transferase (MGD|MGI:88061
FT                   GB|BC005667, evidence: BLASTN, 100%, match=804)"
FT                   /note="putative"
FT                   /db_xref="GOA:P08030"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005764"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="MGI:MGI:88061"
FT                   /db_xref="UniProtKB/Swiss-Prot:P08030"
FT                   /protein_id="BAE31801.1"
FT                   /translation="MSEPELKLVARRIRSFPDFPIPGVLFRDISPLLKDPDSFRASIRL
FT                   LASHLKSTHSGKIDYIAGLDSRGFLFGPSLAQELGVGCVLIRKQGKLPGPTVSASYSLE
FT                   YGKAELEIQKDALEPGQRVVIVDDLLATGGTMFAACDLLHQLRAEVVECVSLVELTSLK
FT                   GRERLGPIPFFSLLQYD"
FT   polyA_signal    812..817
FT                   /note="putative"
FT   polyA_site      831
FT                   /note="putative"
XX
SQ   Sequence 831 BP; 155 A; 253 C; 235 G; 188 T; 0 other;
     ggatacctac ctcctccctg cctcctacac gcacgcggcc atgtcggaac ctgagttgaa        60
     actggtggcg cggcgcatcc gcagcttccc cgacttccca atcccgggcg tgctgttcag       120
     ggatatctcg cccctcttga aagacccgga ctccttccga gcttccatcc gcctcttggc       180
     cagtcacctg aagtccacgc acagcggcaa gatcgactac atcgcaggtc tagactccag       240
     gggcttcctg tttggccctt ccctagctca ggagctgggc gtgggctgtg tgctcatccg       300
     gaaacagggg aagctgccgg gccccactgt gtcagcctcc tattctctgg agtatgggaa       360
     ggctgagctg gaaatccaga aagatgcctt ggaacccggg cagagagtgg tcattgtgga       420
     tgacctcctg gccacaggag gaaccatgtt tgcggcctgt gacctgctgc accagctccg       480
     ggctgaagtg gtggagtgtg tgagcctggt ggagctgacc tcgctgaagg gcagggagag       540
     gctaggacct ataccattct tctctctcct ccagtatgac tgaggagctg gctagatggt       600
     cacacccctg ctcccagcag caccaggaac tgcttggtgg ctcagcccag gcgcctaagt       660
     gacctttgtg agctaccggc cgcccttttg tgagtgttat cactcattcc tttggtcagc       720
     tgatccgccg tgcctgtgga cccctggatc cttgtacttt gtacacgtgc cacacaccct       780
     ggagcatagc agagctgtgc tactggagat caataaaccg ttttgatatg c                831
//


spacer
spacer