Dbfetch

ID   AK152889; SV 1; linear; mRNA; HTC; MUS; 1132 BP.
XX
AC   AK152889;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 12)
XX
DE   Mus musculus bone marrow macrophage cDNA, RIKEN full-length enriched
DE   library, clone:I830089H05 product:1-acyl-sn-glycerol-3-phosphate
DE   acyltransferase epsilon (EC 2.3.1.51) (1-AGP acyltransferase 5) (1-AGPAT 5)
DE   (Lysophosphatidic acid acyltransferase-epsilon) (LPAAT-epsilon)
DE   (1-acylglycerol-3-phosphate O-acyltransferase 5), full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1132
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 73361fbb01dbb0a465bcb47b59cfa752.
DR   Ensembl-Gn; ENSMUSG00000031467; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033405; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0033386; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0033316; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033386; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033099; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0033898; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032421; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0033072; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0033226; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0033174; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0033319; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033211; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0033915; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032134; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0032537; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000149565; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0088283; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0088369; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0088300; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0088318; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0087882; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0088832; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0088412; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0087828; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0088027; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0087864; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0088056; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0087903; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0089122; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0087821; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0086920; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by David A. Hume ( Depts. of Biochemistry
CC   and Microbiology/Parasitology Institute for Molecular Bioscience
CC   University of Queensland Brisbane,Q 4072 Australia ) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=I830089H05
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1132
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="I830089H05"
FT                   /cell_type="macrophage"
FT                   /tissue_type="bone marrow"
FT                   /db_xref="taxon:10090"
FT   CDS             29..1126
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="1-acyl-sn-glycerol-3-phosphate acyltransferase
FT                   epsilon (EC 2.3.1.51) (1-AGP acyltransferase 5) (1-AGPAT 5)
FT                   (Lysophosphatidic acid acyltransferase-epsilon)
FT                   (LPAAT-epsilon) (1-acylglycerol-3-phosphate
FT                   O-acyltransferase 5) (UniProt|Q9D1E8, evidence: FASTY,
FT                   100%ID, 100%length, match=1095)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q9D1E8"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR032098"
FT                   /db_xref="MGI:MGI:1196345"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9D1E8"
FT                   /protein_id="BAE31572.1"
FT                   /translation="MLLSLVLHTYSMRYLLPSVLLLGSAPTYLLAWTLWRVLSALMPAR
FT                   LYQRVDDRLYCVYQNMVLFFFENYTGVQILLYGDLPKNKENVIYLANHQSTVDWIVADM
FT                   LAARQDALGHVRYVLKDKLKWLPLYGFYFAQHGGIYVKRSAKFNDKEMRSKLQSYVNAG
FT                   TPMYLVIFPEGTRYNATYTKLLSASQAFAAQRGLAVLKHVLTPRIKATHVAFDSMKSHL
FT                   DAIYDVTVVYEGNEKGSGKYSNPPSMTEFLCKQCPKLHIHFDRIDRNEVPEEQEHMKKW
FT                   LHERFEIKDRLLIEFYDSPDPERRNKFPGKSVHSRLSVKKTLPSVLILGSLTAVMLMTE
FT                   SGRKLYMGTWLYGTLLGCLWFVIKA"
XX
SQ   Sequence 1132 BP; 317 A; 248 C; 281 G; 286 T; 0 other;
     tgggagtcgc ggctggcgag ccgagaggat gctgctgtcc ctggtgctcc acacgtactc        60
     tatgcgctac ctgctcccca gcgtcctgtt gctgggctcg gcgcccacct acctgctggc       120
     ctggacgctg tggcgggtgc tctccgcgct gatgcccgcc cgcctgtacc agcgcgtgga       180
     cgaccggctt tactgcgtct accagaacat ggtgctcttc ttcttcgaga actacaccgg       240
     ggtccagata ttgctatatg gagatttgcc aaaaaataaa gaaaatgtaa tatatctagc       300
     gaatcatcaa agcacagttg actggattgt tgcggacatg ctggctgcca gacaggatgc       360
     cctaggacat gtgcgctacg tactgaaaga caagttaaaa tggcttccgc tgtatgggtt       420
     ctactttgct cagcatggag gaatttatgt aaaacgaagt gccaaattta atgataaaga       480
     aatgagaagc aagctgcaga gctatgtgaa cgcaggaaca ccgatgtatc ttgtgatttt       540
     cccagaggga acaaggtata atgcaacata cacaaaactc ctttcagcca gtcaggcatt       600
     tgctgctcag cggggccttg cagtattaaa acacgtactg acaccaagaa taaaggccac       660
     tcacgttgct tttgattcta tgaagagtca tttagatgca atttatgatg tcacagtggt       720
     ttatgaaggg aatgagaaag gttcaggaaa atactcaaat ccaccatcca tgactgagtt       780
     tctctgcaaa cagtgcccaa aacttcatat tcactttgat cgtatagaca gaaatgaagt       840
     tccagaggaa caagaacaca tgaaaaagtg gcttcatgag cgctttgaga taaaagatag       900
     gttgctcata gagttctatg attcaccaga tccagaaaga agaaacaaat ttcctgggaa       960
     aagtgttcat tccagactaa gtgtgaagaa gactttacct tcagtgttga tcttggggag      1020
     tttgactgct gtcatgctga tgacggagtc cggaaggaaa ctgtacatgg gcacctggtt      1080
     gtatggaacc ctccttggct gcctgtggtt tgttattaaa gcataagcaa gt              1132
//