spacer

EBI Dbfetch

ID   AK152709; SV 1; linear; mRNA; HTC; MUS; 1131 BP.
XX
AC   AK152709;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 12)
XX
DE   Mus musculus bone marrow macrophage cDNA, RIKEN full-length enriched
DE   library, clone:I830082P14 product:1-acyl-sn-glycerol-3-phosphate
DE   acyltransferase epsilon (EC 2.3.1.51) (1-AGP acyltransferase 5) (1-AGPAT 5)
DE   (Lysophosphatidic acid acyltransferase-epsilon) (LPAAT-epsilon)
DE   (1-acylglycerol-3-phosphate O-acyltransferase 5), full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1131
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 98a879d90d38b5dd8383fc04234ce69f.
DR   Ensembl-Gn; ENSMUSG00000031467; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000149565; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by David A. Hume ( Depts. of Biochemistry
CC   and Microbiology/Parasitology Institute for Molecular Bioscience
CC   University of Queensland Brisbane,Q 4072 Australia ) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=I830082P14
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1131
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="I830082P14"
FT                   /cell_type="macrophage"
FT                   /tissue_type="bone marrow"
FT                   /db_xref="taxon:10090"
FT   CDS             25..1122
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="1-acyl-sn-glycerol-3-phosphate acyltransferase
FT                   epsilon (EC 2.3.1.51) (1-AGP acyltransferase 5) (1-AGPAT 5)
FT                   (Lysophosphatidic acid acyltransferase-epsilon)
FT                   (LPAAT-epsilon) (1-acylglycerol-3-phosphate
FT                   O-acyltransferase 5) (UniProt|Q9D1E8, evidence: FASTY,
FT                   100%ID, 100%length, match=1095)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q9D1E8"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="MGI:MGI:1196345"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9D1E8"
FT                   /protein_id="BAE31436.1"
FT                   /translation="MLLSLVLHTYSMRYLLPSVLLLGSAPTYLLAWTLWRVLSALMPAR
FT                   LYQRVDDRLYCVYQNMVLFFFENYTGVQILLYGDLPKNKENVIYLANHQSTVDWIVADM
FT                   LAARQDALGHVRYVLKDKLKWLPLYGFYFAQHGGIYVKRSAKFNDKEMRSKLQSYVNAG
FT                   TPMYLVIFPEGTRYNATYTKLLSASQAFAAQRGLAVLKHVLTPRIKATHVAFDSMKSHL
FT                   DAIYDVTVVYEGNEKGSGKYSNPPSMTEFLCKQCPKLHIHFDRIDRNEVPEEQEHMKKW
FT                   LHERFEIKDRLLIEFYDSPDPERRNKFPGKSVHSRLSVKKTLPSVLILGSLTAVMLMTE
FT                   SGRKLYMGTWLYGTLLGCLWFVIKA"
XX
SQ   Sequence 1131 BP; 317 A; 249 C; 280 G; 285 T; 0 other;
     ggtcgcggct ggcgagccga gaggatgctg ctgtccctgg tgctccacac gtactctatg        60
     cgctacctgc tccccagcgt cctgttgctg ggctcggcgc ccacctacct gctggcctgg       120
     acgctgtggc gggtgctctc cgcgctgatg cccgcccgcc tgtaccagcg cgtggacgac       180
     cggctttact gcgtctacca gaacatggtg ctcttcttct tcgagaacta caccggggtc       240
     cagatattgc tatatggaga tttgccaaaa aataaagaaa atgtaatata tctagcgaat       300
     catcaaagca cagttgactg gattgttgcg gacatgctgg ctgccagaca ggatgcccta       360
     ggacatgtgc gctacgtact gaaagacaag ttaaaatggc ttccgctgta tgggttctac       420
     tttgctcagc atggaggaat ttatgtaaaa cgaagtgcca aatttaatga taaagaaatg       480
     agaagcaagc tgcagagcta tgtgaacgca ggaacaccga tgtatcttgt gattttccca       540
     gagggaacaa ggtataatgc aacatacaca aaactccttt cagccagtca ggcatttgct       600
     gctcagcggg gccttgcagt attaaaacac gtactgacac caagaataaa ggccactcac       660
     gttgcttttg attctatgaa gagtcattta gatgcaattt atgatgtcac agtggtttat       720
     gaagggaatg agaaaggttc aggaaaatac tcaaatccac catccatgac tgagtttctc       780
     tgcaaacagt gcccaaaact tcatattcac tttgatcgta tagacagaaa tgaagttcca       840
     gaggaacaag aacacatgaa aaagtggctt catgagcgct ttgagataaa agataggttg       900
     ctcatagagt tctatgattc accagatcca gaaagaagaa acaaatttcc tgggaaaagt       960
     gttcattcca gactaagtgt gaagaagact ttaccttcag tgttgatctt ggggagtttg      1020
     actgctgtca tgctgatgac ggagtccgga aggaaactgt acatgggcac ctggttgtat      1080
     ggaaccctcc ttggctgcct gtggtttgtt attaaagcat aagcaagtag c               1131
//


spacer
spacer