spacer

EBI Dbfetch

ID   AK152652; SV 1; linear; mRNA; HTC; MUS; 3672 BP.
XX
AC   AK152652;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus bone marrow macrophage cDNA, RIKEN full-length enriched
DE   library, clone:I830081N02 product:UDP-Gal:betaGlcNAc beta
DE   1,4-galactosyltransferase, polypeptide 5, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3672
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 6633764bfce6f4ec7fa76a268fa7df1a.
DR   Ensembl-Gn; ENSMUSG00000017929; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109221; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by David A. Hume ( Depts. of Biochemistry
CC   and Microbiology/Parasitology Institute for Molecular Bioscience
CC   University of Queensland Brisbane,Q 4072 Australia ) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=I830081N02
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3672
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="I830081N02"
FT                   /cell_type="macrophage"
FT                   /tissue_type="bone marrow"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..783
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase,
FT                   polypeptide 5 (MGD|MGI:1927169 GB|AK079138, evidence:
FT                   BLASTN, 99%, match=1466)"
FT                   /note="putative"
FT                   /note="start codon is not identified"
FT                   /db_xref="GOA:Q3U7I0"
FT                   /db_xref="InterPro:IPR003859"
FT                   /db_xref="InterPro:IPR027791"
FT                   /db_xref="InterPro:IPR027995"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="MGI:MGI:1927169"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U7I0"
FT                   /protein_id="BAE31389.1"
FT                   /translation="MSEIAMDDIHELFSRDPAIKLGGHWKPADCVPRWKVAILIPFRNR
FT                   HEHLPVLLRHLLPMLQRQRLQFAFYVIEQVGTQPFNRAMLFNVGFQEAMKDLDWDCLIF
FT                   HDVDHIPESDRNYYGCGQMPRHFATKLDKYMYLLPYTEFFGGVSGLTVEQFRKINGFPN
FT                   AFWGWGGEDDDLWNRVQNAGYSVSRPEGDTGKYKSIPHHHRGEVQFLGRYALLRKSKER
FT                   QGLDGLNNLNYSANVTYDALYKNITVNLTPELAQVTEY"
XX
SQ   Sequence 3672 BP; 780 A; 951 C; 970 G; 971 T; 0 other;
     atgagtgaga tcgcaatgga cgatattcat gagctgttct ccagagaccc ggccattaag        60
     ctcggagggc actggaagcc tgcagactgt gtgcctcggt ggaaggtggc tatcctcatc       120
     cccttccgga accgccatga gcacctcccg gtcctcctga gacacctgct ccccatgctt       180
     cagcgccagc gcctgcagtt cgccttctat gtgatcgagc aagttggcac ccagcccttt       240
     aaccgagcca tgcttttcaa tgttggtttt caagaagcca tgaaggactt ggattgggat       300
     tgtctgatct tccatgacgt cgatcacata cctgagagtg accgaaacta ctatggctgc       360
     gggcagatgc ccaggcactt tgcaaccaag ctggacaagt acatgtacct gctgccctac       420
     actgagtttt ttggtggcgt gagcggcctg actgtagaac agtttcggaa aatcaatggc       480
     tttcctaatg ccttctgggg ctggggcgga gaagatgacg acttgtggaa cagggtacaa       540
     aatgcaggct attctgtgag ccggccagaa ggggacacag gaaaatacaa gtccattcct       600
     caccaccatc gaggagaggt ccagtttctt ggcaggtacg ctctgctgag gaagtcaaag       660
     gagcggcaag gactggatgg cctcaacaac ctgaactact ctgcgaatgt cacgtacgac       720
     gccttgtata aaaacataac tgtcaacttg acacccgagc tggctcaggt gactgagtac       780
     tgagatgcga agagaagccg cactcaccta cccaccgctc ccttggacgg gctgcgaccc       840
     gccatcctgg gggtcaacac aggaggacag aagagagtgg agcacaggac cataggggtt       900
     ccagaaaact gtcacagagc acacgcacaa aggccttcgc tgtagggccc aacagggaca       960
     ggagacttga ggacacctgt catcagcact ggtgtctatt ccacaagaca gatgtctgcc      1020
     ctgccactcc cttccgtccg tccctgtccg tccccccccc ccccaccgcc cccaggtcct      1080
     gtctcagctg caacccatag aactgcaggg ccaggctagg tgccccttgg atagatgggt      1140
     ggccaagccc cctggcctga aggcccgtct ctgcatctct acagttctct ttggttttca      1200
     tttttcattt ggcttagttt aggggttttt gtttgtttgg gtttttttgt tttgttttgt      1260
     tttgttttgt tttggttttg gtttgtttgt ggggttttgg ggttgttttt ttttttggtg      1320
     gttttttttt ttttttttta aagaaaaatt ttctgctttg ggtggggact gaggacagag      1380
     gggagggact tggtgtgata gacatataac agtcacttct tgaagaagtg cagttgtaaa      1440
     taagccatgt aaaatgcctt tttaaagttt aattttatag ctggctccac atcaaagtga      1500
     gggcctcata tgttagatca ccttgggtgg caaacacccc agttcccacg cagttgagtg      1560
     tcatcaccca agtccctgtc atctaggaag gaagtggatg cagggtggaa caaagaacct      1620
     ccggtcactg tagcccctct tctctgctct gcccctcctt tcctgtcccc tcctttagcc      1680
     ccttccccca aggacttcct cctggagact cagcccctaa gctggaactg ctgttagggg      1740
     cacagtgctc tcccctctta cagacccagc ggagccagct gggatgtgca ggggagggga      1800
     ggcaaaggcc cagggcacag gcttatcact ccagtatgga tggcgggagc tagagaccag      1860
     gagatatgag gccagtgtga gctgtgtcac aagttccagg tcagcctgtg ctgtgtagca      1920
     cagtccagct ccctacacct cctcacacac acagtggctg ctgggtgacc gttccctttt      1980
     ttctttggaa cttggccaca gtttctctgg gctgtgcctg catgaccagc tggcttcagt      2040
     gatttctccg tttccctctt tagtttctag gaagccactg tgctgtgcta agaagcagtt      2100
     ggtcaggagg gctcagccca ggagcaggtg gccctggggt gcatgtcagc caggggccag      2160
     tcagcccagc agtctcccct gctccctgac atgagttcct aaagggcact gaaaagggca      2220
     cctccttcct gtgtctgcct ccactgcacc cccagtccct aaagcaggga tcgtgtgtgg      2280
     tgaggaacgc tctcttctgg cctcaagctc tttgcctctt tgccttcagc acccttgatg      2340
     ttcatggttt acatgggtgg gggtgggatg tagatatgtg ggggtggggt tttgcatcac      2400
     acagttggtt ctgaggacag atgatcccca cagactgtgg gagtgattgg ccaggccttg      2460
     ttttttcttg tgttttgttc tttttgtaga ctagtgtggt aactagggaa cagatggcac      2520
     tgcagagtgc ttcccgctca tatgagagag caggtgtctg cccttgagag ctggtgagcc      2580
     gcgtcatctg tttgcgctgg gcaaggagct gcaccgctgc gttgacctgc cttgtcttac      2640
     ggtacacaca gcaataaagc ctgggttccg cccggtctcc accctccctc cgcctccctt      2700
     ggttagtttc acagtgctgg caatgaagcc cgtggcccac cacgctaggc gagtgctctg      2760
     ccactgagtc acggcccagc cctctctccc tcattcttct gtttccatac caaaggccag      2820
     gagtgcttca ctgtgctgga gccatggtgt cctttggagg gacaacggtg cacgcggcat      2880
     gtatcctggc tgaagcgctg caatcttaca ctagccacag ggtactgttt tgagccaaag      2940
     gctgatactt aattgaagag ggaaaatgca gatttgggga caaaggtctt tttactgctc      3000
     aagtagggtc gcttctgtcc tgttgcaatc atgtccaagt ttgtttttag tgtggacttt      3060
     tgtgggcact gtctgtcatt ggccacccag tcacgtaccg agtgggcagt gtcacagcca      3120
     aagcctacca ctgagccaca gcgtaggtca ttgcttgaaa aaaatgacag tgacaatgga      3180
     gtgtgacctt ggtgtactgt ggcagcccag atgactgagt gctacagacg agtgaccctt      3240
     agatgacctc ctcaactgcc tgccttgtgt gtgcgcgcaa ggcccctctc tgcacagggg      3300
     ttcttcgggg gagggggtat ttgcaaaacc ttaattttgt taaaatgggg gactctgtca      3360
     ggggactctg tcatcgcttc ccttcctcag aggacagcac agagccgcgg cgtacacact      3420
     gacgtaccca ccaccaacag attgaggcac tgacgcagcc agcttagccc agcattactg      3480
     tctctgttgt gagcttgctc tttgttttaa aaggtgccag gggtacattt ttgcactgaa      3540
     acctaaagat gttttaaaaa cacttttcac agaaatagtc cttgtcatta cattgttcac      3600
     tcatgtgttt gtacattttt gtatgttaat ttatgaatga ttttttcagt aaaaaataca      3660
     tattcaataa cc                                                          3672
//


spacer
spacer