Dbfetch

ID   AK152263; SV 1; linear; mRNA; HTC; MUS; 1675 BP.
XX
AC   AK152263;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus bone marrow macrophage cDNA, RIKEN full-length enriched
DE   library, clone:I830057L15 product:adipose differentiation related protein,
DE   full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1675
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; e5f9b8230d5b7377cd0127998c7dc65b.
DR   Ensembl-Gn; ENSMUSG00000028494; mus_musculus.
DR   Ensembl-Gn; MGP_DBA2J_G0028227; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027273; mus_musculus_pwkphj.
DR   Ensembl-Tr; ENSMUST00000000466; mus_musculus.
DR   Ensembl-Tr; MGP_DBA2J_T0065955; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_PWKPhJ_T0065771; mus_musculus_pwkphj.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by David A. Hume ( Depts. of Biochemistry
CC   and Microbiology/Parasitology Institute for Molecular Bioscience
CC   University of Queensland Brisbane,Q 4072 Australia ) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=I830057L15
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1675
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="I830057L15"
FT                   /cell_type="macrophage"
FT                   /tissue_type="bone marrow"
FT                   /db_xref="taxon:10090"
FT   CDS             70..1347
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="adipose differentiation related protein
FT                   (MGD|MGI:87920 GB|NM_007408, evidence: BLASTN, 99%,
FT                   match=1674)"
FT                   /note="putative"
FT                   /db_xref="GOA:P43883"
FT                   /db_xref="InterPro:IPR004279"
FT                   /db_xref="MGI:MGI:87920"
FT                   /db_xref="UniProtKB/Swiss-Prot:P43883"
FT                   /protein_id="BAE31081.1"
FT                   /translation="MAAAVVDPQQSVVMRVANLPLVSSTYDLVSSAYVSTKDQYPYLRS
FT                   VCEMAEKGVKTVTSAAMTSALPIIQKLEPQIAVANTYACKGLDRMEERLPILNQPTSEI
FT                   VASARGAVTGAKDVVTTTMAGAKDSVASTVSGVVDKTKGAVTGSVERTKSVVNGSINTV
FT                   LGMVQFMNSGVDNAITKSELLVDQYFPLTQEELEMEAKKVEGFDMVQKPSNYERLESLS
FT                   TKLCSRAYHQALSRVKEAKQKSQETISQLHSTVHLIEFARKNMHSANQKIQGAQDKLYV
FT                   SWVEWKRSIGYDDTDESHCVEHIESRTLAIARNLTQQLQTTCQTVLVNAQGLPQNIQDQ
FT                   AKHLGVMAGDIYSVFRNAASFKEVSDGVLTSSKGQLQKMKESLDEVMDYFVNNTPLNWL
FT                   VGPFYPQSTEVNKASLKVQQSEVKAQ"
FT   regulatory      1655..1660
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      1675
FT                   /note="putative"
XX
SQ   Sequence 1675 BP; 420 A; 415 C; 457 G; 383 T; 0 other;
     gctggaccgt gcggacttgc tcgtccctca gctctcctgt taggcgtctc ttttctccag        60
     gaggaaaaaa tggcagcagc agtagtggat ccgcaacaga gcgtggtgat gagagtggcc       120
     aacctgccct tggtgagctc tacctacgac cttgtgtcct ccgcttatgt cagtacaaag       180
     gatcagtacc cgtatttgag atccgtgtgt gagatggccg agaagggcgt gaagaccgtg       240
     acctctgcgg ccatgacaag tgccctgccc atcatccaga agctggagcc acaaattgcg       300
     gttgccaata cctatgcctg caaggggcta gacaggatgg aggaaagact gcctattctg       360
     aaccagccaa cgtccgagat tgttgccagt gccagaggtg ccgtaactgg ggcgaaggat       420
     gtggtgacga ctaccatggc tggagccaag gattctgtag ccagcacagt ctcaggggtg       480
     gtggataaga ccaaaggagc agtgactggc agcgtggaaa ggaccaagtc tgtggtcaat       540
     ggcagcatca atacagtttt ggggatggtg cagttcatga acagtggagt agataatgcc       600
     atcaccaagt cggagctgct ggtagaccag tacttccctc tcactcagga ggagctggag       660
     atggaagcaa aaaaggtgga aggatttgat atggttcaga agccgagcaa ctatgaacgg       720
     ctggagtccc tgtctaccaa gctctgctct cgggcttatc accaggctct cagcagggtt       780
     aaagaggcca aacaaaagag ccaggagacc atttctcagc tccactccac tgtccacctg       840
     attgaattcg ccaggaagaa tatgcacagt gccaaccaga aaattcaggg tgctcaggat       900
     aagctctatg tctcgtgggt ggagtggaag agaagcatcg gctacgacga caccgatgag       960
     tcccactgtg ttgagcacat cgagtcacgt actctggcta tcgcccgcaa cctgacccag      1020
     cagctccaga ctacatgcca gactgtcctg gtcaacgccc aagggttacc acagaacatt      1080
     caagatcagg ccaaacactt gggggtgatg gcaggcgaca tctactccgt attccgcaat      1140
     gctgcctcct ttaaggaagt gtccgatggc gtcctcacat ctagcaaggg gcagctgcag      1200
     aaaatgaagg aatccttaga tgaagttatg gattactttg ttaacaacac gcctctcaac      1260
     tggctggtag gtccctttta tcctcagtct accgaggtga acaaggccag cctgaaggtc      1320
     cagcagtctg aggtcaaagc tcagtaaacc catccttgtc accagagcat gatgttgctg      1380
     gccagatgac cccttttgct gtattgaaat taacttggta gatggcttta gcttagaaaa      1440
     gcagcttctt agaaccaagg gcctcattat ggtcactcac agctcagtta tggtcttgcc      1500
     ccagctggcc ctggcacagg agttctctta cctggctggt gagtggcctg tgttagtctt      1560
     gtgaggacct cgaggaacct aaaagctcag atgcacttac agtcttgtct gtggcctttg      1620
     tattgttatt ggctgtaaac gtctgtctgg accgaataaa gattcattca cgtgg           1675
//