spacer

EBI Dbfetch

ID   AK152092; SV 1; linear; mRNA; HTC; MUS; 1856 BP.
XX
AC   AK152092;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus bone marrow macrophage cDNA, RIKEN full-length enriched
DE   library, clone:I830047H13 product:adenylosuccinate lyase, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1856
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; b97b955020e46afeb2a1106fd1b359d3.
DR   Ensembl-Gn; ENSMUSG00000022407; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000023043; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by David A. Hume ( Depts. of Biochemistry
CC   and Microbiology/Parasitology Institute for Molecular Bioscience
CC   University of Queensland Brisbane,Q 4072 Australia ) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=I830047H13
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1856
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="I830047H13"
FT                   /cell_type="macrophage"
FT                   /tissue_type="bone marrow"
FT                   /db_xref="taxon:10090"
FT   CDS             31..1485
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="adenylosuccinate lyase (MGD|MGI:103202 GB|BC020187,
FT                   evidence: BLASTN, 99%, match=1855)"
FT                   /note="putative"
FT                   /db_xref="GOA:P54822"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="MGI:MGI:103202"
FT                   /protein_id="BAE30940.1"
FT                   /translation="MAASGDPGSAESYRSPLAARYASREMCFLFSDRYKFQTWRQLWLW
FT                   LAEAEQTLGLPITDEQIQEMKSNLNNIDFQMAAEEEKRLRHDVMAHVHTFGHCCPKAAG
FT                   IIHLGATSCYVGDNTDLIILRNAFDLLLPKLARVISRLADFAKDRADLPTLGFTHFQPA
FT                   QLTTVGKRCCLWIQDLCMDLQNLKRVRDELRFRGVKGTTGTQASFLQLFEGDHQKVEQL
FT                   DKMVTEKAGFKRAFIITGQTYTRKVDIEVLSVLASLGASVHKICTDIRLLANLKEMEEP
FT                   FEKQQIGSSAMPYKRNPMRSERCCSLARHLMALTMDPLQTASVQWFERTLDDSANRRIC
FT                   LAEAFLTADTILNTLQNISEGLVVYPKVIERRIRQELPFMATENIIMAMVKAGGSRQDC
FT                   HEKIRVLSQQAAAVVKQEGGDNDLIERIRADAYFSPIHSQLEHLLDPSSFTGRAPQQVH
FT                   RFLEEEVRPLLKPYGNEMAVKAELCL"
FT   polyA_signal    1842..1847
FT                   /note="putative"
FT   polyA_site      1856
FT                   /note="putative"
XX
SQ   Sequence 1856 BP; 466 A; 479 C; 513 G; 398 T; 0 other;
     ggtccgccgc gtcctggtcg cgtgttgaaa atggctgcat ccggcgaccc tggcagtgct        60
     gaaagttacc gttctccgct ggcggcccgc tacgccagcc gcgagatgtg tttcttgttc       120
     agcgacaggt acaagttcca gacgtggcgg cagctgtggc tgtggctggc ggaggccgaa       180
     cagacgctgg gtttgcctat cacagatgaa caaatccagg agatgaagtc gaacctgaac       240
     aacattgact tccagatggc agctgaggaa gagaagcgcc tgcggcacga cgtgatggct       300
     cacgtgcaca cgtttggcca ctgctgtccg aaagctgcgg gcattattca tctgggcgcc       360
     acctcctgct atgtcggaga caatacggac ctgattattc tgagaaatgc atttgaccta       420
     cttttgccaa agcttgctag agtgatctcg aggcttgccg actttgctaa ggatcgtgct       480
     gatctgccca cgttaggttt cacacacttt cagcctgctc agctgaccac ggttgggaaa       540
     cgatgctgcc tttggattca agatctctgc atggatctcc agaacttgaa gcgtgtccgg       600
     gatgagctgc gcttccgagg agtaaagggc accactggca cgcaggccag cttcctgcag       660
     ctcttcgagg gggatcacca gaaggtggag cagctggaca agatggtgac agaaaaggca       720
     gggtttaaaa gagccttcat catcacagga cagacgtaca cacggaaagt ggacatcgaa       780
     gtgctgtctg tgctggccag cttaggagca tcggtgcaca agatttgcac tgacatacgc       840
     ctgctggcaa acctgaagga gatggaggag ccctttgaga aacagcagat tggctccagt       900
     gcgatgccgt acaagcggaa ccccatgcgc tccgaacgtt gctgcagcct ggcccgtcac       960
     ctgatggccc ttaccatgga cccactacag acagcgtctg tgcagtggtt tgaacgtact      1020
     ctggatgaca gtgccaaccg acggatctgt ttggctgaag cgtttctcac tgcagatact      1080
     atattaaaca ccctacagaa catttctgaa ggattggtgg tgtaccccaa agtaattgaa      1140
     cggcgcattc ggcaagagct gcctttcatg gccacagaga acatcatcat ggcaatggtg      1200
     aaagccgggg gcagccgaca ggactgccat gagaaaatta gagtgctttc ccagcaggca      1260
     gctgctgtgg tcaagcagga aggaggtgac aatgacctta tagagcgcat ccgggcagat      1320
     gcctacttca gccccatcca ctcacagctg gagcacttgc tggacccctc ttctttcact      1380
     ggccgagcac cccagcaggt ccacagattc ctggaagagg aagtgcgccc cctgctaaag      1440
     ccctatggga atgagatggc ggtgaaagca gagctgtgtc tgtagagtag gagagctgag      1500
     gagaacccgg ttacagtgat tagagcttgc tgattacagt gttagagtta ctactgtgtt      1560
     ctgcggcact cctttacaca ctcaggaggc agaggcaggc agatctctga gttcaaggcc      1620
     agcctggtct acaaaacaag ttccaggaca gccagagcta cacagagaaa ccctgtctca      1680
     acaaacaaac aaacagaggc tggggacatg gcactgactg ctcttccaaa ggtcctgagt      1740
     tcaaatccca gcaaccacat ggtggctcac aaccatctgt aatgagatct gatgccctct      1800
     tctggtgcat gaagacagct acagtgtatt catatacata aaataaatga atcttt          1856
//


spacer
spacer