Dbfetch

ID   AK152081; SV 1; linear; mRNA; HTC; MUS; 1689 BP.
XX
AC   AK152081;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus bone marrow macrophage cDNA, RIKEN full-length enriched
DE   library, clone:I830047F06 product:adipose differentiation related protein,
DE   full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1689
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 2fcd16eaae2377094fb180633dd8119f.
DR   Ensembl-Gn; ENSMUSG00000028494; mus_musculus.
DR   Ensembl-Gn; MGP_DBA2J_G0028227; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027273; mus_musculus_pwkphj.
DR   Ensembl-Tr; ENSMUST00000000466; mus_musculus.
DR   Ensembl-Tr; MGP_DBA2J_T0065955; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_PWKPhJ_T0065771; mus_musculus_pwkphj.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by David A. Hume ( Depts. of Biochemistry
CC   and Microbiology/Parasitology Institute for Molecular Bioscience
CC   University of Queensland Brisbane,Q 4072 Australia ) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=I830047F06
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1689
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="I830047F06"
FT                   /cell_type="macrophage"
FT                   /tissue_type="bone marrow"
FT                   /db_xref="taxon:10090"
FT   CDS             78..1355
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="adipose differentiation related protein
FT                   (MGD|MGI:87920 GB|NM_007408, evidence: BLASTN, 99%,
FT                   match=1686)"
FT                   /note="putative"
FT                   /db_xref="GOA:P43883"
FT                   /db_xref="InterPro:IPR004279"
FT                   /db_xref="MGI:MGI:87920"
FT                   /db_xref="UniProtKB/Swiss-Prot:P43883"
FT                   /protein_id="BAE30931.1"
FT                   /translation="MAAAVVDPQQSVVMRVANLPLVSSTYDLVSSAYVSTKDQYPYLRS
FT                   VCEMAEKGVKTVTSAAMTSALPIIQKLEPQIAVANTYACKGLDRMEERLPILNQPTSEI
FT                   VASARGAVTGAKDVVTTTMAGAKDSVASTVSGVVDKTKGAVTGSVERTKSVVNGSINTV
FT                   LGMVQFMNSGVDNAITKSELLVDQYFPLTQEELEMEAKKVEGFDMVQKPSNYERLESLS
FT                   TKLCSRAYHQALSRVKEAKQKSQETISQLHSTVHLIEFARKNMHSANQKIQGAQDKLYV
FT                   SWVEWKRSIGYDDTDESHCVEHIESRTLAIARNLTQQLQTTCQTVLVNAQGLPQNIQDQ
FT                   AKHLGVMAGDIYSVFRNAASFKEVSDGVLTSSKGQLQKMKESLDEVMDYFVNNTPLNWL
FT                   VGPFYPQSTEVNKASLKVQQSEVKAQ"
FT   regulatory      1663..1668
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      1689
FT                   /note="putative"
XX
SQ   Sequence 1689 BP; 420 A; 420 C; 462 G; 387 T; 0 other;
     ggtggtgatc tggaccgtgc ggacttgctc gtccctcagc tctcctgtta ggcgtctctt        60
     ttctccagga ggaaaaaatg gcagcagcag tagtggatcc gcaacagagc gtggtgatga       120
     gagtggccaa cctgcccttg gtgagctcta cctacgacct tgtgtcctcc gcttatgtca       180
     gtacaaagga tcagtacccg tatttgagat ccgtgtgtga gatggccgag aagggcgtga       240
     agaccgtgac ctctgcggcc atgacaagtg ccctgcccat catccagaag ctggagccac       300
     aaattgcggt tgccaatacc tatgcctgca aggggctaga caggatggag gaaagactgc       360
     ctattctgaa ccagccaacg tccgagattg ttgccagtgc cagaggtgcc gtaactgggg       420
     cgaaggatgt ggtgacgact accatggctg gagccaagga ttctgtagcc agcacagtct       480
     caggggtggt ggataagacc aaaggagcag tgactggcag cgtggaaagg accaagtctg       540
     tggtcaatgg cagcatcaat acagttttgg ggatggtgca gttcatgaac agtggagtag       600
     ataatgccat caccaagtcg gagctgctgg tagaccagta cttccctctc actcaggagg       660
     agctggagat ggaagcaaaa aaggtggaag gatttgatat ggttcagaag ccgagcaact       720
     atgaacggct ggagtccctg tctaccaagc tctgctctcg ggcttatcac caggctctca       780
     gcagggttaa agaggccaaa caaaagagcc aggagaccat ttctcagctc cactccactg       840
     tccacctgat tgaattcgcc aggaagaata tgcacagtgc caaccagaaa attcagggtg       900
     ctcaggataa gctctatgtc tcgtgggtgg agtggaagag aagcatcggc tacgacgaca       960
     ccgatgagtc ccactgtgtt gagcacatcg agtcacgtac tctggctatc gcccgcaacc      1020
     tgacccagca gctccagact acatgccaga ctgtcctggt caacgcccaa gggttaccac      1080
     agaacattca agatcaggcc aaacacttgg gggtgatggc aggcgacatc tactccgtat      1140
     tccgcaatgc tgcctccttt aaggaagtgt ccgatggcgt cctcacatct agcaaggggc      1200
     agctgcagaa aatgaaggaa tccttagatg aagttatgga ttactttgtt aacaacacgc      1260
     ctctcaactg gctggtaggt cccttttatc ctcagtctac cgaggtgaac aaggccagcc      1320
     tgaaggtcca gcagtctgag gtcaaagctc agtaaacccc tccttgtcac cagagcatga      1380
     tgttgctggc cagatgaccc cttttgctgt attgaaatta acttggtaga tggctttagc      1440
     ttagaaaagc agcttcttag aaccaagggc ctcattatgg tcactcacag ctcagttatg      1500
     gtcttgcccc agctggccct ggcacaggag ttctcttacc tggctggtga gtggcctgtg      1560
     ttagtcttgt gaggacctcg aggaacctaa aagctcagat gcacttacag tcttgtctgt      1620
     ggcctttgta ttgttattgg ctgtaaacgt ctgtctggac cgaataaaga ttcattcacg      1680
     tggcctccg                                                              1689
//