spacer

EBI Dbfetch

ID   AK151856; SV 1; linear; mRNA; HTC; MUS; 1446 BP.
XX
AC   AK151856;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus bone marrow macrophage cDNA, RIKEN full-length enriched
DE   library, clone:I830041A03 product:chemokine (C-C motif) receptor-like 2,
DE   full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1446
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 7d96c3b2b4e2cfad6e54f3a751767c8e.
DR   Ensembl-Gn; ENSMUSG00000043953; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000111888; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by David A. Hume ( Depts. of Biochemistry
CC   and Microbiology/Parasitology Institute for Molecular Bioscience
CC   University of Queensland Brisbane,Q 4072 Australia ) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=I830041A03
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1446
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="I830041A03"
FT                   /cell_type="macrophage"
FT                   /tissue_type="bone marrow"
FT                   /db_xref="taxon:10090"
FT   CDS             269..1351
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="chemokine (C-C motif) receptor-like 2
FT                   (MGD|MGI:1920904 GB|AB009384, evidence: BLASTN, 99%,
FT                   match=1432)"
FT                   /note="putative"
FT                   /db_xref="GOA:O35457"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000355"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1920904"
FT                   /protein_id="BAE30745.1"
FT                   /translation="MDNYTVAPDDEYDVLILDDYLDNSGPDQVPAPEFLSPQQVLQFCC
FT                   AVFAVGLLDNVLAVFILVKYKGLKNLGNIYFLNLALSNLCFLLPLPFWAHTAAHGESPG
FT                   NGTCKVLVGLHSSGLYSEVFSNILLLVQGYRVFSQGRLASIFTTVSCGIVACILAWAMA
FT                   TALSLPESVFYEPRMERQKHKCAFGKPHFLPIEAPLWKYVLTSKMIILVLAFPLLVFII
FT                   CCRQLRRRQSFRERQYDLHKPALVITGVFLLMWAPYNTVLFLSAFQEHLSLQDEKSSYH
FT                   LDASVQVTQLVATTHCCVNPLLYLLLDRKAFMRYLRSLFPRCNDIPYQSSGGYQQAPPR
FT                   EGHGRPIELYSNLHQRQDII"
XX
SQ   Sequence 1446 BP; 323 A; 389 C; 340 G; 394 T; 0 other;
     gcttccagct gcttgcaaca ctctttgctt tctgacgtag gaatgctcac accagacttg        60
     catttagcag cgctcctttt ctgtccagct ctgtccccaa cctccttccc gactgatacc       120
     acttgcttcc atgttctctg cttgtcctcg tgcttgacca gcgcagtttc acttttgcaa       180
     acatctgttt atatcccttg agagaaaaaa tatcaagcaa cctgcctcaa acgacgctgt       240
     tttgtccggt gagcaaggac agcctccgat ggataactac acagtggccc cggacgatga       300
     atatgatgtc ctaatcttag acgactacct ggacaacagt gggccggacc aagttccggc       360
     ccccgagttc ctctcccccc agcaggtgct gcagttctgc tgcgcggtgt ttgcggtggg       420
     tctcttggac aacgtgctgg cggtgtttat cttggtgaaa tacaaaggac tcaagaatct       480
     ggggaacatc tacttcctaa acctggcact ttcaaacctg tgtttcctgc ttcccctgcc       540
     gttctgggcc catactgcag cacacgggga aagccctggc aatgggacct gtaaagttct       600
     tgtcggactc cactcctcgg gcttatacag cgaggtgttt tccaacatcc tcctccttgt       660
     gcaaggatac agggtgtttt cccaagggcg actggcctcc atcttcacga cagtgtcttg       720
     tggtattgtt gcgtgcatcc tggcatgggc catggctact gcgctctctt tgcccgagtc       780
     tgtgttttat gagcctcgga tggaaagaca gaaacacaag tgtgcctttg gcaaacctca       840
     cttcttgcca atcgaagcgc cgctctggaa gtacgttctg acgtcaaaaa tgatcatctt       900
     ggtacttgct tttcctctgc tggtttttat aatctgctgc aggcaactga ggagaaggca       960
     gagcttcagg gagagacagt acgacctcca caagccggct cttgtcataa cgggcgtgtt      1020
     ccttttgatg tgggcgcctt acaacactgt gcttttcctg tctgctttcc aggaacactt      1080
     gtccctgcag gatgagaaga gcagctacca cctggacgca agtgttcagg tcacacagct      1140
     ggtagcgacc acccactgct gcgtcaaccc gctgctctat ttgcttcttg accggaaggc      1200
     ctttatgaga taccttcgca gcctgttccc acggtgcaat gatatcccct atcaaagtag      1260
     tggaggctat cagcaagcgc ctccaaggga aggtcatggc aggcccattg aactgtacag      1320
     caatttgcat caaaggcagg atataatata atataaacac tcaaccttgt ctcttcacat      1380
     tgttttatgc catttttata tgtttgtata aaaatagaat ataagaggaa agggggctgg      1440
     ttaatg                                                                 1446
//


spacer
spacer