spacer

EBI Dbfetch

ID   AK151697; SV 1; linear; mRNA; HTC; MUS; 1195 BP.
XX
AC   AK151697;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus bone marrow macrophage cDNA, RIKEN full-length enriched
DE   library, clone:I830034G06 product:glutathione reductase 1, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1195
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 03a7ee5f81764827e1a78b55eb2412ac.
DR   Ensembl-Gn; ENSMUSG00000031584; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033992; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by David A. Hume ( Depts. of Biochemistry
CC   and Microbiology/Parasitology Institute for Molecular Bioscience
CC   University of Queensland Brisbane,Q 4072 Australia ) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=I830034G06
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1195
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="I830034G06"
FT                   /cell_type="macrophage"
FT                   /tissue_type="bone marrow"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..330
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="glutathione reductase 1 (MGD|MGI:95804 GB|NM_010344,
FT                   evidence: BLASTN, 99%, match=1195)"
FT                   /note="putative"
FT                   /note="start codon is not identified"
FT                   /db_xref="GOA:Q3U9P5"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="MGI:MGI:95804"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U9P5"
FT                   /protein_id="BAE30621.1"
FT                   /translation="VVFSHPPIGTVGLTEDEAVHKYGKDNVKIYSTAFTPMYHAVTTRK
FT                   TKCVMKMVCANKEEKVVGIHMQGIGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSSEE
FT                   LVTLR"
XX
SQ   Sequence 1195 BP; 285 A; 231 C; 274 G; 405 T; 0 other;
     gtggtcttca gccacccccc tattgggacc gtggggctca ctgaagacga agctgttcat        60
     aagtatggga aagacaatgt gaaaatctac tcgactgcct ttaccccgat gtatcacgct       120
     gtgaccacga ggaagacgaa atgcgtcatg aagatggttt gtgccaacaa agaggaaaag       180
     gtggttggca ttcacatgca ggggattggc tgtgatgaga tgctgcaggg cttcgctgta       240
     gcggtgaaaa tgggggccac caaggccgac ttcgacaaca cagttgccat tcatcctacc       300
     tcttcagagg agctggtcac cctgcgctga gagcctgggg acccaggtgg ctagcggtgc       360
     gaccagcagg cctccgggag gaaccgatcg agtttacgcc cagcttctac agatctctgt       420
     attttaatca ggaatttctg gtggtgtaaa tttccagcta tacacacgca cagaagaact       480
     tatgtatcta atcagaaggt tgttttgtta atccggggtt ggttttcatt tgataatatt       540
     tataattaat attttgattt ttttgttgtt gtttaattaa cagccttgtg tttgttgtgt       600
     ttttcttgct ttggccccat tccaagttta aatgtacatg acatacactc aagttagtgt       660
     acctgatgga tgaatattgc tggctaattt cttttatttt ttattttttt ccttttttta       720
     tgcagcccaa ggtggcctca aacaactcag aaacctccag ctatagcctc atgggtgctg       780
     gaattctagg cctgcatggc ctctcctggc ctagcttgct agttttatat gatgggaagt       840
     ctgcagaata tacgtggtat ttttgttctg tattggaaag ctgccccaat gttacctctc       900
     tattcttgtt ttattctttg ctctgtgtta aatgatttaa aatggtttgt gttattttca       960
     tggaacaaag tgcattaaag ttagacttga ggctggttag gtaaaggaga aatgacagta      1020
     catgcaagac ggaaggctga ggcactcggg agccctttct tcttctgagt attcctggtt      1080
     cattcagtca tttctgtatc tctgcgtttg tttttttttt ttgttttgtt ttttatgaaa      1140
     actgttccaa atttttgaaa ttcactgcat tgtcttataa aatttattac gaact           1195
//


spacer
spacer