spacer

EBI Dbfetch

ID   AK151565; SV 1; linear; mRNA; HTC; MUS; 1410 BP.
XX
AC   AK151565;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus bone marrow macrophage cDNA, RIKEN full-length enriched
DE   library, clone:I830031M14 product:Adiponectin receptor protein 1, full
DE   insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1410
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 186a0dabd7a32dd77f1bfc62b541c026.
DR   Ensembl-Gn; ENSMUSG00000026457; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027727; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112237; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by David A. Hume ( Depts. of Biochemistry
CC   and Microbiology/Parasitology Institute for Molecular Bioscience
CC   University of Queensland Brisbane,Q 4072 Australia ) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=I830031M14
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1410
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="I830031M14"
FT                   /cell_type="macrophage"
FT                   /tissue_type="bone marrow"
FT                   /db_xref="taxon:10090"
FT   CDS             212..1339
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="Adiponectin receptor protein 1 (UniProt|Q91VH1,
FT                   evidence: FASTY, 100%ID, 100%length, match=1125)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q53YY4"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="MGI:MGI:1919924"
FT                   /db_xref="UniProtKB/TrEMBL:Q53YY4"
FT                   /protein_id="BAE30507.1"
FT                   /translation="MSSHKGSAGAQGNGAPSGNREADTVELAELGPLLEEKGKRAASSP
FT                   AKAEEDQACPVPQEEEEEVRVLTLPLQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWL
FT                   KDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYF
FT                   MAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVP
FT                   WLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVP
FT                   TMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIF
FT                   HVLVVAAAFVHFYGVSNLQEFRYGLEGGCTDDSLL"
XX
SQ   Sequence 1410 BP; 268 A; 407 C; 400 G; 335 T; 0 other;
     gcttccggcg cgggcagggc gctgaggatc gggcgcccct cggccgcagg ccgcctccag        60
     tgccgcggga tgtagcgccc gggcccgcgg cccccagcag aggcagccag ccaggcctgt       120
     ccaccatcac aggaagatct ctgccctctg gggctgagag accccaacct ttcttcaagc       180
     tgaagctgcc aggcactgag gtaccagcca gatgtcttcc cacaaaggct ctgccggggc       240
     acaaggcaat ggggctcctt ctggtaacag agaagctgac acagtggagc tggctgagct       300
     ggggcccctg ctggaggaga agggcaagcg ggcagccagc agcccagcca aggctgagga       360
     agatcaagca tgcccggtgc ctcaggaaga ggaggaggag gtgcgggtgc tgacgcttcc       420
     tctgcaagcc caccatgcca tggagaagat ggaggagttc gtgtataagg tctgggaggg       480
     acgttggaga gtcatcccgt atgatgtgct tcctgactgg ctgaaagaca acgactacct       540
     gctacatggc cacagaccac ctatgccctc ctttcgggct tgcttcaaga gcatcttccg       600
     catccacaca gagactggca acatctggac acatctgctt ggttttgtgc tatttctctt       660
     tctgggaatc ttgacgatgc tgagaccaaa tatgtacttc atggctcccc tgcaggagaa       720
     ggtggtcttc gggatgttct tcctgggcgc ggtgctctgc ctcagtttct cctggctctt       780
     ccacactgtc tactgtcatt cagagaaggt ctctcggact ttttccaaac tggactattc       840
     agggattgct ctactgatta tggggagctt cgttccctgg ctctattact ccttctactg       900
     ctccccacag ccgcggctca tctacctctc catcgtctgt gtcctgggca tctctgccat       960
     cattgtggca cagtgggacc ggtttgccac tcccaagcac cggcagacaa gagcaggagt      1020
     gttcctggga cttggcttga gtggtgttgt acccaccatg cactttacta tcgctgaggg      1080
     ctttgtcaag gccaccacgg tgggccagat gggctggttc ttcctcatgg ctgtgatgta      1140
     catcaccggc gccggcctgt atgctgctcg gattcctgag cgcttcttcc ctggaaaatt      1200
     tgacatctgg ttccagtctc atcagatttt ccacgtcctg gtggtggcag cagctttcgt      1260
     ccacttctat ggtgtgtcca accttcagga attccgttat ggcctagaag gtggctgtac      1320
     cgacgactcc cttctctgag cctccccacc tgaggggtgg aggagggact tcccaagtgc      1380
     ttttaaaaat aacttctttg ctgaagtatg                                       1410
//


spacer
spacer