spacer

EBI Dbfetch

ID   AK151073; SV 1; linear; mRNA; HTC; MUS; 998 BP.
XX
AC   AK151073;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus bone marrow macrophage cDNA, RIKEN full-length enriched
DE   library, clone:I830022H12 product:prohibitin, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-998
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; b25aa8832955bd561e2e16ca70b05481.
DR   Ensembl-Gn; ENSMUSG00000038845; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000125172; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by David A. Hume ( Depts. of Biochemistry
CC   and Microbiology/Parasitology Institute for Molecular Bioscience
CC   University of Queensland Brisbane,Q 4072 Australia ) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=I830022H12
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..998
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="I830022H12"
FT                   /cell_type="macrophage"
FT                   /tissue_type="bone marrow"
FT                   /db_xref="taxon:10090"
FT   CDS             59..877
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="prohibitin (MGD|MGI:97572 GB|NM_008831, evidence:
FT                   BLASTN, 99%, match=995)"
FT                   /note="putative"
FT                   /db_xref="GOA:P67778"
FT                   /db_xref="InterPro:IPR000163"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="MGI:MGI:97572"
FT                   /db_xref="UniProtKB/Swiss-Prot:P67778"
FT                   /protein_id="BAE30089.1"
FT                   /translation="MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGV
FT                   QDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLP
FT                   RIYTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGL
FT                   ILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAE
FT                   LIANSLATAGDGLIELRKLEAAEDIAYQLSRSWNITYLPAGQSVLLQLPQ"
FT   polyA_signal    979..984
FT                   /note="putative"
FT   polyA_site      998
FT                   /note="putative"
XX
SQ   Sequence 998 BP; 238 A; 260 C; 288 G; 212 T; 0 other;
     gaaattcatg tggaggtcag agtgaaagca ggtgtgagtg gaagcaacag aaggagtcat        60
     ggctgccaaa gtgtttgagt ccattggaaa gttcggcctg gcgttggcag ttgcaggagg       120
     cgtggtgaac tctgctttgt ataatgtgga tgctggacac agagctgtca tctttgaccg       180
     attccgtggc gtacaggaca ttgtggtcgg ggaagggact catttcctca tcccttgggt       240
     acagaaacca attatctttg actgccgctc tcgaccacgg aacgtaccag tcatcactgg       300
     tagcaaagac ttgcagaacg tcaatatcac actgcgaatc ctcttccggc cggtggccag       360
     ccagcttcct cgtatctaca ccagcattgg cgaggactat gatgagcggg tcctgccttc       420
     tatcaccaca gagatcctca agtcggtggt ggctcgattc gatgctggag aattgattac       480
     ccagcgagag ctggtctcca ggcaggtgag cgatgacctc acagagcgag cggcaacatt       540
     tgggcttatc ctggatgacg tgtccctgac acatctgacc ttcgggaagg agttcacaga       600
     ggcagtagaa gccaaacagg tggctcagca ggaagcggag agagccagat ttgtggtgga       660
     aaaggctgag cagcagaaga aggcagccat catctctgct gagggtgact ccaaggccgc       720
     tgagctgatc gccaactcgc tggccacggc aggcgacggc ctgatcgagc tgcggaagct       780
     ggaggccgcc gaggacattg cgtaccagct ctcccgctct tggaacatca cctacctgcc       840
     agcgggccag tccgtgcttc tccagcttcc ccagtgaggc cagccgggcc acggcctcca       900
     tcatgctgaa tgacgccttc cttctgcccc accccagaaa atcactgtga aatttcatga       960
     ttggcttaaa gtgaaggaaa taaaggtaaa atcacttc                               998
//


spacer
spacer