spacer

EBI Dbfetch

ID   AK150782; SV 1; linear; mRNA; HTC; MUS; 2373 BP.
XX
AC   AK150782;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus bone marrow macrophage cDNA, RIKEN full-length enriched
DE   library, clone:I830015F18 product:transferrin, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2373
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; f601244dec002ec3b533d0cedb2794ff.
DR   Ensembl-Gn; ENSMUSG00000032554; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035158; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112645; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by David A. Hume ( Depts. of Biochemistry
CC   and Microbiology/Parasitology Institute for Molecular Bioscience
CC   University of Queensland Brisbane,Q 4072 Australia ) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=I830015F18
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2373
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="I830015F18"
FT                   /cell_type="macrophage"
FT                   /tissue_type="bone marrow"
FT                   /db_xref="taxon:10090"
FT   CDS             104..2197
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="transferrin (MGD|MGI:98821 GB|AK085754, evidence:
FT                   BLASTN, 99%, match=2315)"
FT                   /db_xref="GOA:Q921I1"
FT                   /db_xref="InterPro:IPR001156"
FT                   /db_xref="InterPro:IPR016357"
FT                   /db_xref="InterPro:IPR018195"
FT                   /db_xref="MGI:MGI:98821"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q921I1"
FT                   /protein_id="BAE29847.1"
FT                   /translation="MRLTVGALLACAALGLCLAVPDKTVKWCAVSEHENTKCISFRDHM
FT                   KTVLPPDGPRLACVKKTSYPDCIKAISASEADAMTLDGGWVYDAGLTPNNLKPVAAEFY
FT                   GSVEHPQTYYYAVAVVKKGTDFQLNQLEGKESCHTGLGRSAGWVIPIGLLFCKLSEPRS
FT                   PLEKAVSSFFSGSCVPCADPVAFPKLCQLCPGCGCSSTQPFFGYVGAFKCLKDGGGDVA
FT                   FVKHTTIFEVLPEKADRDQYELLCLDNTRKPVDQYEDCYLARIPSHAVVARKNNGKEDL
FT                   IWEILKVAQEHFGKGKSKDFQLFSSPLGKDLLFKDSAFGLLRVPPRMDYRLYLGHNYVT
FT                   AIRNQQEGVCPEGSIDNSPVKWCALSHLERTKCDEWSIISEGKIECESAETTEDCIEKI
FT                   VNGEADAMTLDGGHAYIAGQCGLVPVMAEYYESSNCAIPSQQGIFPKGYYAVAVVKASD
FT                   TSITWNNLKGKKSCHTGVDRTAGWNIPMGMLYNRINHCKFDEFFSQGCAPGYEKNSTLC
FT                   DLCIGPLKCAPSNKEEYNGYTGAFRCLVEKGDVAFVKHQTVLDNTEGKNPAEWAKNLKQ
FT                   EDFELLCPDGTRKPVKDFASCHLAQAPNHVVVSRKEKAARVKAVLTSQETLFGGSDCTG
FT                   NFCLFKSTTKDLLFRDDTKCFVKLPEGTTPEKYLGAEYMQSVGNMRKCSTSRLLEACTF
FT                   HKH"
XX
SQ   Sequence 2373 BP; 582 A; 608 C; 652 G; 531 T; 0 other;
     gagccccctc cctccgtgca taaaggcgag cgggccacgg gcaggcggcg cagaagcggg        60
     tcggtctgta ctccccgctc ctcgccatac acacaccgag aggatgaggc tcaccgtggg       120
     tgccctgctg gcctgcgctg ccctggggct gtgtctggct gtccctgaca aaacggtcaa       180
     atggtgcgca gtgtcagagc acgagaatac caagtgcatc agcttccgtg accacatgaa       240
     gaccgtcctt ccgcctgatg gcccccggct tgcctgtgtg aagaaaacct cctatccgga       300
     ttgcatcaag gccatttctg caagtgaagc cgatgctatg accttggatg ggggttgggt       360
     gtacgatgcc ggcctgactc cgaacaacct gaagcccgtg gcggcggagt tttatggatc       420
     agtggaacat ccacagacct actactacgc tgtggctgtg gtaaagaagg gaacagactt       480
     ccagctgaac cagctcgaag gcaaggagtc ctgccacaca ggcctgggaa ggtctgcagg       540
     ctgggtcatc cccattggct tgctcttctg taagctgtcg gagccccgca gtcctcttga       600
     gaaagctgtg tccagtttct tctcgggcag ttgtgtcccc tgtgcagatc cagtggcctt       660
     ccccaaactg tgtcaactgt gcccaggctg tggctgctcc tccactcaac cattctttgg       720
     ctacgtaggc gcattcaagt gtctgaaaga tggcggtggg gatgtggcct ttgtcaagca       780
     cacaaccata tttgaggtct tgccggagaa ggctgacagg gaccaatatg aactgctctg       840
     ccttgacaat acccgcaagc cagtggatca gtatgaggat tgctacctgg ctcggatccc       900
     ttctcatgct gttgtggctc gaaaaaacaa tggcaaggaa gacttgatct gggagattct       960
     caaagtggca caggaacact ttggcaaagg caaatcaaaa gacttccaac tgttcagctc      1020
     tcctcttggg aaagacctgc tgtttaaaga ttctgccttt gggctgttaa gggtcccccc      1080
     aaggatggac tacaggctgt accttggcca taactatgtc actgccattc ggaatcagca      1140
     ggaaggcgtg tgcccggagg gctcgatcga caactcgcca gtgaagtggt gtgcactgag      1200
     tcacctggag agaaccaagt gtgacgagtg gagcatcatc agtgagggaa agatagagtg      1260
     tgagtcagca gagaccactg aggactgcat tgaaaagatt gtgaacggag aagcggacgc      1320
     catgactttg gatggaggac atgcctacat tgcaggccag tgtggtctag tgcctgtcat      1380
     ggcagagtac tacgagagct ctaattgtgc catcccatca caacaaggta tctttcctaa      1440
     agggtattat gccgtggctg tggtgaaggc atcggacact agcatcacct ggaacaacct      1500
     gaaaggcaag aagtcctgcc acactggggt agacagaacc gctggttgga acatccctat      1560
     gggcatgctg tacaacagga tcaaccactg caaattcgat gaatttttca gtcaaggctg      1620
     cgctcccggg tatgagaaga attccaccct ctgtgacctg tgtattggcc cactcaaatg      1680
     tgctccgagc aacaaagagg aatataatgg ttacacaggg gctttcaggt gtctcgttga      1740
     gaaaggagat gtagcctttg tgaaacacca gactgtcctg gataacaccg aaggaaagaa      1800
     ccctgccgaa tgggctaaga atctgaagca ggaagacttc gagttgctct gccctgatgg      1860
     caccaggaag cctgtgaaag attttgccag ctgccacctg gcccaagctc caaaccatgt      1920
     tgtggtctca cgaaaagaga aggcagcccg ggttaaggct gtactgacta gccaggagac      1980
     tttatttggg ggaagtgact gcaccggcaa tttctgtttg ttcaagtcca ccaccaagga      2040
     ccttctgttc agggatgaca ccaaatgttt cgttaaactt ccagagggta ccacacctga      2100
     aaaatactta ggagcggagt acatgcaatc tgtcggtaac atgaggaagt gctcaacctc      2160
     acgactcctg gaagcctgca ctttccacaa acattaaaat ccaagaggtg ggttgccact      2220
     gtggtggaga cagatgctcc ctcccgtggc ccatgggctt ctcttggtct tcatgccctg      2280
     aggggttggg gctaactggt gtagtcttcg ctgctgtgcc ttaccacata cacagagcac      2340
     aaaataaaaa cgactgctga ctttatattt ccc                                   2373
//


spacer
spacer