spacer

EBI Dbfetch

ID   AK150582; SV 1; linear; mRNA; HTC; MUS; 2041 BP.
XX
AC   AK150582;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus bone marrow macrophage cDNA, RIKEN full-length enriched
DE   library, clone:I830012F24 product:interleukin 4 induced 1, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2041
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 9f92d43157dc5c632e1e06bfddf900e7.
DR   Ensembl-Gn; ENSMUSG00000074141; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033015; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by David A. Hume ( Depts. of Biochemistry
CC   and Microbiology/Parasitology Institute for Molecular Bioscience
CC   University of Queensland Brisbane,Q 4072 Australia ) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=I830012F24
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2041
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="I830012F24"
FT                   /cell_type="macrophage"
FT                   /tissue_type="bone marrow"
FT                   /db_xref="taxon:10090"
FT   CDS             48..1940
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="interleukin 4 induced 1 (MGD|MGI:109552
FT                   GB|NM_010215, evidence: BLASTN, 99%, match=2040)"
FT                   /note="putative"
FT                   /db_xref="GOA:O09046"
FT                   /db_xref="InterPro:IPR001613"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="MGI:MGI:109552"
FT                   /db_xref="PDB:2I8W"
FT                   /db_xref="UniProtKB/Swiss-Prot:O09046"
FT                   /protein_id="BAE29676.1"
FT                   /translation="MAGLALRLVLAATLLGLAGSLDWKAASSLNPIEKCMEDHDYEQLL
FT                   KVVTLGLNRTSKPQKVVVVGAGVAGLVAAKMLSDAGHKVTILEADNRIGGRIFTFRDEK
FT                   TGWIGELGAMRMPSSHRILHKLCRTLGLNLTQFTQYDENTWTEVHNVKLRNYVVEKMPE
FT                   KLGYNLNNRERGHSPEDIYQMALNKAFKDLKALGCKKAMNKFNKHTLLEYLLEEGNLSR
FT                   PAVQLLGDVMSEEGFFYLSFAEALRAHACLSDRLRYSRIVGGWDLLPRALLSSLSGALL
FT                   LNAPVVSITQGRNDVRVHIATSLHSEKTLTADVVLLTASGPALQRITFSPPLTRKRQEA
FT                   LRALHYVAASKVFLSFRRPFWHEEHIEGGHSNTDRPSRLIFYPAQGEGSLLLASYTWSD
FT                   AAAPFAGLSTDQTLRLVLQDVAALHGPVVFRLWDGRGVVKRWAEDPHSQGGFVVQPPLY
FT                   GREAEDYDWSAPFGRIYFAGEHTALPHGWVETAVKSGLRAAVRINNNYGYGEVDPQMME
FT                   HAYAEANYLDQYPEGERPEEQQAREEVSPDEQEPSHKHLLVETSPEGQQHAFVEAIPEL
FT                   QGHVFVETVPQEKGHAHQNIYPSEHVQVHGEVIPEWHGHGGSGTPQMHRVGDHS"
FT   polyA_signal    2019..2024
FT                   /note="putative"
FT   polyA_site      2041
FT                   /note="putative"
XX
SQ   Sequence 2041 BP; 446 A; 579 C; 636 G; 380 T; 0 other;
     ggcagtcctg cccaagagag ctgaagacag cagctgccac ttgagccatg gctgggctgg        60
     ccctgcgtct tgtcctggcg gccaccctcc ttggtctggc aggctctctg gactggaagg       120
     cagcctccag cttgaaccct attgagaagt gtatggagga ccacgattat gagcagctac       180
     tcaaggtggt gaccttgggc ctcaatcgga cttcgaagcc ccagaaggtg gtagtggttg       240
     gtgcaggcgt ggcagggctg gtagcagcca agatgctcag tgatgcagga cacaaggtca       300
     ccatcctgga ggcagataac aggattgggg gccgtatctt cactttccgg gatgagaaga       360
     caggctggat aggggagctt ggggccatgc gaatgcccag ctctcacagg atcttgcaca       420
     agctctgcag gaccctgggc ctcaacctga ctcagttcac acagtatgat gagaacacgt       480
     ggacggaggt gcataatgtg aagctgcgaa actatgtggt ggagaagatg ccagaaaagc       540
     tgggctacaa cctgaacaac agggaaaggg gccattcccc agaggacatc taccagatgg       600
     cactcaacaa ggccttcaaa gacctcaagg ccttgggctg caagaaagcc atgaataagt       660
     tcaacaagca tacgcttctg gaatacctcc tcgaggaggg caacctgtcc cggccggctg       720
     tgcagctcct gggagatgtg atgtccgagg agggcttctt ctacctcagc tttgcagaag       780
     ccttacgtgc gcacgcctgc ctgagcgata gactccggta cagccgcatc gtaggtggct       840
     gggacctgct tccgcgagct ctgctgagct cactgtccgg ggcgctgcta ctgaacgcgc       900
     ctgtggtgtc gatcactcag gggaggaacg atgtgcgcgt gcacattgcc acctcgcttc       960
     acagcgagaa gacgctgaca gccgacgtgg tgctgctgac tgccagtgga cccgcgctgc      1020
     agcgcattac cttctcgccg cccttgactc gcaagaggca ggaggcactg cgcgcgcttc      1080
     actacgtagc agccagcaag gtttttctga gtttccgtcg gcccttctgg cacgaggagc      1140
     acatcgaggg cggccactcc aacactgacc gcccatcgcg cctcatattc tatcccgcgc      1200
     agggcgaggg ctcactgctt ctggcctcct acacgtggtc ggacgctgca gcccccttcg      1260
     ctggactgag caccgaccag accctgcgtt tggtgctcca ggacgtggcg gccctgcacg      1320
     ggcctgtggt gttccggctg tgggacggca ggggtgtggt caagcgctgg gcagaggacc      1380
     cgcatagcca gggaggcttc gtggtgcagc cgccattgta cgggcgcgag gctgaggact      1440
     atgactggtc agcccccttc ggccgcattt acttcgcggg cgagcacaca gctctcccgc      1500
     atggctgggt agagaccgct gtcaagtccg ggttgcgggc cgcggtgaga atcaataata      1560
     actatgggta cggggaggtc gacccccaga tgatggagca tgcatatgca gaggccaact      1620
     atctggacca gtatcctgaa ggggagaggc ccgaggagca gcaggcgcgg gaagaagtca      1680
     gcccagatga acaggagccc tctcacaaac acttgttggt ggaaacgagc cccgaggggc      1740
     agcaacacgc gtttgtggag gccattcccg agctgcaggg acacgtgttc gtggagactg      1800
     tcccccagga gaaggggcac gcccaccaga atatatatcc ttcggagcat gtacaggtgc      1860
     atggggaagt catccctgag tggcatggtc atgggggatc tggcaccccg caaatgcacc      1920
     gagtggggga ccactcctaa tcgcaaagag gaagtgagca cccagctcct aagccagccc      1980
     tcttcagggc agacagacca cctacactaa tagcccacaa taaagttatt tttgttaaac      2040
     c                                                                      2041
//


spacer
spacer