spacer

EBI Dbfetch

ID   AK150177; SV 1; linear; mRNA; HTC; MUS; 1682 BP.
XX
AC   AK150177;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus bone marrow macrophage cDNA, RIKEN full-length enriched
DE   library, clone:G530141O19 product:adipose differentiation related protein,
DE   full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1682
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 45119a974dc9df7b9e53855f55032da3.
DR   Ensembl-Gn; ENSMUSG00000028494; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000000466; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by David A. Hume ( Depts. of Biochemistry
CC   and Microbiology/Parasitology Institute for Molecular Bioscience
CC   University of Queensland Brisbane,Q 4072 Australia ) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=G530141O19
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1682
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="G530141O19"
FT                   /cell_type="macrophage"
FT                   /tissue_type="bone marrow"
FT                   /db_xref="taxon:10090"
FT   CDS             79..1356
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="adipose differentiation related protein
FT                   (MGD|MGI:87920 GB|NM_007408, evidence: BLASTN, 99%,
FT                   match=1682)"
FT                   /note="putative"
FT                   /db_xref="GOA:P43883"
FT                   /db_xref="InterPro:IPR004279"
FT                   /db_xref="MGI:MGI:87920"
FT                   /db_xref="UniProtKB/Swiss-Prot:P43883"
FT                   /protein_id="BAE29361.1"
FT                   /translation="MAAAVVDPQQSVVMRVANLPLVSSTYDLVSSAYVSTKDQYPYLRS
FT                   VCEMAEKGVKTVTSAAMTSALPIIQKLEPQIAVANTYACKGLDRMEERLPILNQPTSEI
FT                   VASARGAVTGAKDVVTTTMAGAKDSVASTVSGVVDKTKGAVTGSVERTKSVVNGSINTV
FT                   LGMVQFMNSGVDNAITKSELLVDQYFPLTQEELEMEAKKVEGFDMVQKPSNYERLESLS
FT                   TKLCSRAYHQALSRVKEAKQKSQETISQLHSTVHLIEFARKNMHSANQKIQGAQDKLYV
FT                   SWVEWKRSIGYDDTDESHCVEHIESRTLAIARNLTQQLQTTCQTVLVNAQGLPQNIQDQ
FT                   AKHLGVMAGDIYSVFRNAASFKEVSDGVLTSSKGQLQKMKESLDEVMDYFVNNTPLNWL
FT                   VGPFYPQSTEVNKASLKVQQSEVKAQ"
FT   regulatory      1664..1669
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      1682
FT                   /note="putative"
XX
SQ   Sequence 1682 BP; 420 A; 417 C; 459 G; 386 T; 0 other;
     gcgtggtgat ctggaccgtg cggacttgct cgtccctcag ctctcctgtt aggcgtctct        60
     tttctccagg aggaaaaaat ggcagcagca gtagtggatc cgcaacagag cgtggtgatg       120
     agagtggcca acctgccctt ggtgagctct acctacgacc ttgtgtcctc cgcttatgtc       180
     agtacaaagg atcagtaccc gtatttgaga tccgtgtgtg agatggccga gaagggcgtg       240
     aagaccgtga cctctgcggc catgacaagt gccctgccca tcatccagaa gctggagcca       300
     caaattgcgg ttgccaatac ctatgcctgc aaggggctag acaggatgga ggaaagactg       360
     cctattctga accagccaac gtccgagatt gttgccagtg ccagaggtgc cgtaactggg       420
     gcgaaggatg tggtgacgac taccatggct ggagccaagg attctgtagc cagcacagtc       480
     tcaggggtgg tggataagac caaaggagca gtgactggca gcgtggaaag gaccaagtct       540
     gtggtcaatg gcagcatcaa tacagttttg gggatggtgc agttcatgaa cagtggagta       600
     gataatgcca tcaccaagtc ggagctgctg gtagaccagt acttccctct cactcaggag       660
     gagctggaga tggaagcaaa aaaggtggaa ggatttgata tggttcagaa gccgagcaac       720
     tatgaacggc tggagtccct gtctaccaag ctctgctctc gggcttatca ccaggctctc       780
     agcagggtta aagaggccaa acaaaagagc caggagacca tttctcagct ccactccact       840
     gtccacctga ttgaattcgc caggaagaat atgcacagtg ccaaccagaa aattcagggt       900
     gctcaggata agctctatgt ctcgtgggtg gagtggaaga gaagcatcgg ctacgacgac       960
     accgatgagt cccactgtgt tgagcacatc gagtcacgta ctctggctat cgcccgcaac      1020
     ctgacccagc agctccagac tacatgccag actgtcctgg tcaacgccca agggttacca      1080
     cagaacattc aagatcaggc caaacacttg ggggtgatgg caggcgacat ctactccgta      1140
     ttccgcaatg ctgcctcctt taaggaagtg tccgatggcg tcctcacatc tagcaagggg      1200
     cagctgcaga aaatgaagga atccttagat gaagttatgg attactttgt taacaacacg      1260
     cctctcaact ggctggtagg tcccttttat cctcagtcta ccgaggtgaa caaggccagc      1320
     ctgaaggtcc agcagtctga ggtcaaagct cagtaaaccc ctccttgtca ccagagcatg      1380
     atgttgctgg ccagatgacc ccttttgctg tattgaaatt aacttggtag atggctttag      1440
     cttagaaaag cagcttctta gaaccaaggg cctcattatg gtcactcaca gctcagttat      1500
     ggtcttgccc cagctggccc tggcacagga gttctcttac ctggctggtg agtggcctgt      1560
     gttagtcttg tgaggacctc gaggaaccta aaagctcaga tgcacttaca gtcttgtctg      1620
     tggcctttgt attgttattg gctgtaaacg tctgtctgga ccgaataaag attcattcac      1680
     gt                                                                     1682
//


spacer
spacer