Dbfetch

ID   AK150009; SV 1; linear; mRNA; HTC; MUS; 4127 BP.
XX
AC   AK150009;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus bone marrow macrophage cDNA, RIKEN full-length enriched
DE   library, clone:G530117I02 product:oxoglutarate dehydrogenase (lipoamide),
DE   full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4127
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 16e096b63be7c652ba74a0b4ea4889da.
DR   Ensembl-Gn; ENSMUSG00000020456; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000003461; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000093350; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000101554; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by David A. Hume ( Depts. of Biochemistry
CC   and Microbiology/Parasitology Institute for Molecular Bioscience
CC   University of Queensland Brisbane,Q 4072 Australia ) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=G530117I02
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4127
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="G530117I02"
FT                   /cell_type="macrophage"
FT                   /tissue_type="bone marrow"
FT                   /db_xref="taxon:10090"
FT   CDS             90..3161
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="oxoglutarate dehydrogenase (lipoamide)
FT                   (MGD|MGI:1098267 GB|BC013670, evidence: BLASTN, 99%,
FT                   match=3998)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q60597"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR031717"
FT                   /db_xref="InterPro:IPR032106"
FT                   /db_xref="MGI:MGI:1098267"
FT                   /db_xref="PDB:3E2H"
FT                   /db_xref="PDB:3TF7"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60597"
FT                   /protein_id="BAE29234.1"
FT                   /translation="MFHLRTCAAKLRPLTASQTVKTFSQNKPAAIRTFQQIRCYSAPVA
FT                   AEPFLSGTSSNYVEEMYCAWLENPKSVHKSWDIFFRNTNAGAPPGTAYQSPLSLSRSSL
FT                   ATMAHAQSLVEAQPNVDKLVEDHLAVQSLIRAYQIRGHHVAQLDPLGILDADLDSSVPA
FT                   DIISSTDKLGFYGLHESDLDKVFHLPTTTFIGGQEPALPLREIIRRLEMAYCQHIGVEF
FT                   MFINDLEQCQWIRQKFETPGIMQFTNEEKRTLLARLVRSTRFEEFLQRKWSSEKRFGLE
FT                   GCEVLIPALKTIIDMSSANGVDYVIMGMPHRGRLNVLANVIRKELEQIFCQFDSKLEAA
FT                   DEGSGDMKYHLGMYHRRINRVTDRNITLSLVANPSHLEAADPVVMGKTKAEQFYCGDTE
FT                   GKKVMSILLHGDAAFAGQGIVYETFHLSDLPSYTTHGTVHVVVNNQIGFTTDPRMARSS
FT                   PYPTDVARVVNAPIFHVNSDDPEAVMYVCKVAAEWRNTFHKDVVVDLVCYRRNGHNEMD
FT                   EPMFTQPLMYKQIRKQKPVLQKYAELLVSQGVVNQPEYEEEISKYDKICEEAFTRSKDK
FT                   KILHIKHWLDSPWPGFFTLDGQPRSMTCPSTGLEEDVLFHIGKVASSVPVENFTIHGGL
FT                   SRILKTRRELVTNRTVDWALAEYMAFGSLLKEGIHVRLSGQDVERGTFSHRHHVLHDQN
FT                   VDKRTCIPMNHLWPNQAPYTVCNSSLSEYGVLGFELGFAMASPNALVLWEAQFGDFNNM
FT                   AQCIIDQFICPGQAKWVRQNGIVLLLPHGMEGMGPEHSSARPERFLQMCNDDPDVLPDL
FT                   QEENFDINQLYDCNWIVVNCSTPGNFFHVLRRQILLPFRKPLIVFTPKSLLRHPEARTS
FT                   FDEMLPGTHFQRVIPENGPAAQDPHKVKRLLFCTGKVYYDLTRERKARNMEEEVAITRI
FT                   EQLSPFPFDLLLKEAQKYPNAELAWCQEEHKNQGYYDYVKPRLRTTIDRAKPVWYAGRD
FT                   PAAAPATGNKKTHLTELQRFLDTAFDLDAFKKFS"
XX
SQ   Sequence 4127 BP; 995 A; 1105 C; 1061 G; 966 T; 0 other;
     ggtggagttt ggagcccgga gtggtgtcgg cgcttcactc gggtggagct gaacgggaga        60
     caggtacttg tggaaggctt caggacaaaa tgtttcattt aaggacttgt gctgctaagt       120
     taaggccatt gacagcctcc cagactgtta agacattttc acaaaacaaa ccagcagcaa       180
     ttaggacgtt tcaacagatt cggtgctatt ctgcacctgt agctgctgaa ccatttctta       240
     gtgggactag ttcgaactat gtggaggaaa tgtactgtgc ctggttggag aatcccaaaa       300
     gtgtacataa gtcatgggac atttttttcc gaaacaccaa tgctggagcc ccaccgggca       360
     ctgcctacca gagccccctt tccctgagtc gaagctccct ggctaccatg gcccatgcac       420
     agtccctggt ggaagcacaa cctaacgtcg acaaactcgt ggaggaccac ttggcggtgc       480
     agtctctcat cagggcatat cagatacgag ggcaccatgt agcacagctg gaccccctgg       540
     ggattttgga tgctgatctg gactcctccg tgcccgctga cattatctca tccacagaca       600
     aacttgggtt ctatggccta cacgagtctg accttgacaa ggtcttccac ttacccacca       660
     ccactttcat cgggggacag gagccagcac ttcctcttcg ggagatcatc cgtcggctgg       720
     agatggccta ctgccagcac attggtgtgg agttcatgtt cattaatgat ttggaacaat       780
     gccagtggat ccgacagaag tttgagaccc ctggaatcat gcagttcacc aatgaggaga       840
     agcggacctt gctggccagg cttgtacgat ccaccaggtt tgaggagttc ctacagcgaa       900
     agtggtcctc ggagaagcgt tttggtctgg aaggctgtga ggtgctgatc cctgccctca       960
     agacaatcat tgatatgtca agtgcaaatg gagtggacta tgtgatcatg gggatgccac      1020
     acagaggacg gctgaacgtg cttgcaaatg tcatcaggaa ggagctggag caaatattct      1080
     gtcagtttga ctcaaagctg gaggcagctg atgagggttc tggggacatg aagtaccacc      1140
     tgggcatgta tcaccgcagg atcaaccgtg tgaccgacag aaacatcact ttgtccttgg      1200
     tggctaaccc ttcccatcta gaggctgctg accctgtcgt gatgggaaag accaaagctg      1260
     aacagttcta ctgtggagac actgaaggga aaaaggtgat gtctatcctg ctgcatgggg      1320
     atgctgcttt tgctggccag ggcatcgtat atgagacctt ccatctcagc gacttgccgt      1380
     cctacacaac ccatggcact gttcatgtgg ttgtcaacaa ccagattggc ttcaccacag      1440
     accctcggat ggcccgctcc tctccctacc ccactgatgt ggcccgagtg gtgaatgccc      1500
     ccattttcca tgtcaactca gatgaccctg aagctgtcat gtatgtatgc aaggtggcag      1560
     ctgagtggag aaacaccttc cacaaggatg ttgtagttga tctggtgtgt tatcgacgaa      1620
     atggccacaa tgagatggac gaacctatgt ttacacagcc actcatgtac aagcagatcc      1680
     gcaagcagaa gcctgtactg cagaagtatg cagaattgct agtctcccag ggtgtcgtca      1740
     atcagcctga gtacgaggag gaaatctcca agtatgataa gatctgtgag gaagcattta      1800
     ccagatccaa agataagaag atcttgcaca tcaagcactg gctggattcc ccctggcctg      1860
     gctttttcac cctggatgga cagcccagga gcatgacctg cccctccact ggcctggagg      1920
     aggatgtctt gttccacatt ggaaaggtgg ccagctctgt acctgtggag aactttacta      1980
     tccatggagg gctgagccgg atcttgaaga cccgcagaga gcttgtgacg aaccggactg      2040
     tggactgggc cctggcagag tacatggcat ttggctcact gctgaaggaa ggcatccatg      2100
     tgcggctgag tggccaggat gtggagcggg gcaccttcag ccatcgccac catgtgctcc      2160
     atgatcagaa tgttgacaaa agaacctgca tccccatgaa ccacctttgg ccaaatcagg      2220
     ccccttacac tgtatgcaac agctcgctgt ctgagtacgg tgtcctgggc tttgagctgg      2280
     gctttgccat ggctagccct aatgctctgg ttctctggga ggcccagttt ggtgacttca      2340
     acaacatggc acagtgcatc attgaccagt tcatctgccc aggacaggca aagtgggtgc      2400
     ggcagaatgg cattgtgctc ctgctgcctc atggcatgga aggcatgggt cccgagcatt      2460
     cctctgcccg cccagagcgg tttctgcaga tgtgcaatga tgacccagat gtcctgcctg      2520
     acctgcagga agaaaacttt gacatcaatc agctctatga ctgcaactgg attgttgtca      2580
     actgttccac ccctggcaac ttcttccatg tgctgcgacg acagatcttg ctgcccttcc      2640
     ggaagccgtt aatcgtcttc actcccaaat ccctcctgcg ccaccctgag gcaagaacta      2700
     gctttgacga gatgctgcca ggaacgcact tccagcgtgt gatcccagaa aatggacctg      2760
     cagctcagga cccacacaaa gtcaagagac ttctcttctg cactgggaag gtgtactatg      2820
     acctcacccg agagcgcaaa gccaggaaca tggaggagga ggtggctatt acaaggattg      2880
     agcagctatc accattcccc tttgacctcc tgctgaaaga ggcacagaag tatcccaatg      2940
     ctgagctggc ctggtgccag gaagagcaca agaaccaagg ctactatgac tatgtcaagc      3000
     caagacttcg taccaccatt gaccgtgcta agcctgtctg gtatgctggc cgagacccgg      3060
     cagctgctcc agccactggc aacaagaaaa cacacctgac agagctgcag cgctttctgg      3120
     acacagcctt tgacctggac gcattcaaga aattctctta gatgctcctg gagttgatga      3180
     ggccatggcc cccatgtcca tgacgctctt tgcttctcaa ctaaagaata gtgcctcagc      3240
     actgtccaca cgtcccttcg ctgtgccaca ccacccctgt tctcatagga attaagttgt      3300
     ccactgcagt gctcagctgc tccccggtca catgctgccc agcctgtgcc gacttctctc      3360
     aggctgcaca ccgttcatgg agaccggaag gagcagaata aggaaagggc ccctctcagg      3420
     acatcctaga gaaggaaggc agctctggcc ccacccatgc ccccagtgca atcctccagg      3480
     gtaggaacag aaccctatgt ggcttcccag ggtactagca ctcagccctc gtcacccatc      3540
     aagtcgcaga ttcaaggcca ggagtagttt catcttgcta gggccaagct gagagctcat      3600
     ggaggaacta tagctgccag gatttgggag tcatcaggat gttgtgtgaa tagagattgt      3660
     catggggtat ttagaggact ttagcagtga tgttagtcta gccctgctac ccttcttggg      3720
     tttgggctgt atgtgggaaa cttaccccag ctaccacgcc tggagagctt ggctctgagt      3780
     acggcccaga agctccattg gctcccaacg ccaggcactg ctgcctcttg gtcctgctgc      3840
     ctctgctctc ctgacccctc cccagtcact tcattttctc tgttgttccc ttgaacacac      3900
     agaagctgtt gacgaattct tttttttgct gtgccaaggc aggtcaaaag cagatcagtg      3960
     gataagagca agttgtccca aggagccagc tgtccttcct ccctcttttg acctccactg      4020
     ggacacacct gatttattta ttttggttaa aaaaaaaaaa ggaaatgaaa aaagaacaac      4080
     cacctttgca ttgcatcggc ttgacccata aactaagtta tcatggc                    4127
//