spacer

EBI Dbfetch

ID   AK149935; SV 1; linear; mRNA; HTC; MUS; 4337 BP.
XX
AC   AK149935;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus bone marrow macrophage cDNA, RIKEN full-length enriched
DE   library, clone:G530106J11 product:phosphatidylinositol 3-kinase catalytic
DE   delta polypeptide, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4337
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 08f16794582717bf7c661dabeb4777d2.
DR   Ensembl-Gn; ENSMUSG00000039936; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105688; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by David A. Hume ( Depts. of Biochemistry
CC   and Microbiology/Parasitology Institute for Molecular Bioscience
CC   University of Queensland Brisbane,Q 4072 Australia ) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=G530106J11
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4337
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="G530106J11"
FT                   /cell_type="macrophage"
FT                   /tissue_type="bone marrow"
FT                   /db_xref="taxon:10090"
FT   CDS             380..3514
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="phosphatidylinositol 3-kinase catalytic delta
FT                   polypeptide (MGD|MGI:1098211 GB|AK040867, evidence: BLASTN,
FT                   99%, match=4109)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q3UDT3"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000341"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR001263"
FT                   /db_xref="InterPro:IPR002420"
FT                   /db_xref="InterPro:IPR003113"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015433"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="MGI:MGI:1098211"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UDT3"
FT                   /protein_id="BAE29178.1"
FT                   /translation="MPPGVDCPMEFWTKEESQSVVVDFLLPTGVYLNFPVSRNANLSTI
FT                   KQVLWHRAQYEPLFHMLSDPEAYVFTCVNQTAEQQELEDEQRRLCDIQPFLPVLRLVAR
FT                   EGDRVKKLINSQISLLIGKGLHEFDSLRDPEVNDFRTKMRQFCEEAAAHRQQLGWVEWL
FT                   QYSFPLQLEPSARGWRAGLLRVSNRALLVNVKFEGSEESFTFQVSTKDMPLALMACALR
FT                   KKATVFRQPLVEQPEEYALQVNGRHEYLYGNYPLCHFQYICSCLHSGLTPHLTMVHSSS
FT                   ILAMRDEQSNPAPQVQKPRAKPPPIPAKKPSSVSLWSLEQPFSIELIEGRKVNADERMK
FT                   LVVQAGLFHGNEMLCKTVSSSEVNVCSEPVWKQRLEFDISVCDLPRMARLCFALYAVVE
FT                   KAKKARSTKKKSKKADCPIAWANLMLFDYKDQLKTGERCLYMWPSVPDEKGELLNPAGT
FT                   VRGNPNTESAAALVIYLPEVAPHPVYFPALEKILELGRHGERGRITEEEQLQLREILER
FT                   RGSGELYEHEKDLVWKMRHEVQEHFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPV
FT                   LSALELLDFSFPDCYVGSFAIKSLRKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLG
FT                   RALANRKIGHFLFWHLRSEMHVPSVALRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKA
FT                   LNDFVKVSSQKTTKPQTKEMMHMCMRQETYMEALSHLQSPLDPSTLLEEVCVEQCTFMD
FT                   SKMKPLWIMYSSEEAGSAGNVGIIFKNGDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTP
FT                   YGCLPTGDRTGLIEVVLHSDTIANIQLNKSNMAATAAFNKDALLNWLKSKNPGEALDRA
FT                   IEEFTLSCAGYCVATYVLGIGDRHSDNIMIRESGQLFHIDFGHFLGNFKTKFGINRERV
FT                   PFILTYDFVHVIQQGKTNNSEKFERFRGYCERAYTILRRHGLLFLHLFALMRAAGLPEL
FT                   SCSKDIQYLKDSLALGKTEEEALKHFRVKFNEALRESWKTKVNWLAHNVSKDNRQ"
XX
SQ   Sequence 4337 BP; 964 A; 1272 C; 1218 G; 883 T; 0 other;
     gtctcgcgcc tagccttggg gctgccagct ccgccgaccc agctgctgga ccggttccca        60
     gcagtgctgg ttcttggctg tagaatccta ccatagggac tttctcctac aaacttgccc       120
     cattgacaca aaaatctgcg ggttccatcc cttctctgct cagctgcatc ggaactgacg       180
     ctcactaagg tcccaccaga actagaggct atgctaagaa caaggcagac atctaaggag       240
     ctgagagcca ggcagaagtg ggatgaagcc cgctgatgcc aaagtacctt taatctccca       300
     ggcagagggg ccttggctgg tggtccttct tggcccatac caaacaggaa aacagacctc       360
     agagaagtaa cacaacagga tgccccctgg ggtggactgc cccatggagt tctggaccaa       420
     agaggagagc cagagcgtgg ttgttgactt cttgctgccc acaggggtct acttgaactt       480
     ccccgtgtcc cgcaatgcca acctcagcac catcaagcag gtgctgtggc accgtgcaca       540
     gtatgagcca ctcttccaca tgctcagtga ccccgaggcc tatgtgttca cctgtgtgaa       600
     ccagacggcg gagcagcagg agttggagga tgagcagcgg aggctgtgcg acatccagcc       660
     cttcctgccc gtgctgcgcc tcgtggcccg agagggggac cgcgtgaaga agctcattaa       720
     ctcccagatc agcctcctca ttggcaaagg tctccatgag tttgattccc tgcgggaccc       780
     ggaagtaaac gacttccgca ctaagatgcg ccagttttgt gaagaggctg ctgctcaccg       840
     ccagcagctg ggctgggtgg aatggctgca gtacagcttc cccctgcagc tggagccctc       900
     agcaaggggt tggcgggccg gcttattgcg tgtcagcaac cgagccctgc tggtcaacgt       960
     gaagttcgag ggcagtgagg agagcttcac cttccaggta tccaccaagg acatgcccct      1020
     ggcactgatg gcctgtgccc tccgaaaaaa ggccacagtg ttccggcagc ctctggtgga      1080
     gcagcctgag gaatatgccc tgcaggtgaa cgggaggcac gaatacctct acggcaacta      1140
     cccgctctgc cactttcagt acatctgcag ctgcctacac agcgggctga cccctcatct      1200
     gaccatggtc cactcctcct ccatccttgc tatgcgggat gagcagagca atcctgcccc      1260
     ccaagtacag aaaccacgtg ccaaacctcc cccgatccct gccaagaagc cctcctctgt      1320
     gtccctgtgg tccctggaac agccattctc cattgagctg atcgagggcc gaaaagtgaa      1380
     tgctgacgag cggatgaagc tggttgttca ggccgggctc ttccatggca atgagatgct      1440
     gtgcaagact gtgtcaagct cggaggtgaa tgtatgctca gagcccgtgt ggaagcagcg      1500
     actggagttc gatatcagcg tctgtgacct cccgcgcatg gctcgactct gttttgctct      1560
     ctatgccgtc gtggagaagg ctaagaaggc acgctccaca aagaagaagt ctaagaaggc      1620
     ggactgcccc atcgcttggg ccaacctcat gctattcgac tacaaagatc agctcaagac      1680
     gggggagcgc tgcctctaca tgtggccctc tgtcccagat gagaagggag agctgctgaa      1740
     tcctgcgggt acagtgcgcg ggaaccccaa cacggagagt gccgctgccc tggtcatcta      1800
     cctgcctgag gtggcccccc accctgtgta cttccccgct ctggagaaga tcctggagct      1860
     ggggcgtcac ggggagcgtg ggcgcatcac ggaggaggag cagctgcagc tgcgggagat      1920
     cctggaacgg cggggatccg gggaactgta cgaacatgag aaggacctgg tgtggaagat      1980
     gcgccacgaa gtccaggagc atttcccaga ggcgctggcc cgcctgctgc tggtcaccaa      2040
     gtggaataaa cacgaggatg tggcccagat gctctatttg ctgtgctcct ggcccgagct      2100
     gcctgtgctg agcgccctgg aacttctgga ctttagcttt cccgactgct acgtgggctc      2160
     cttcgccatc aagtcccttc ggaagctgac ggacgatgag ctcttccagt accttctgca      2220
     gctggtgcaa gtgctcaaat atgagtccta cctggactgc gagctgacca aattcttgct      2280
     gggccgagcc ctggctaacc gcaagatcgg acacttcctg ttctggcacc tccgctctga      2340
     gatgcacgta ccatcagtgg ctctgcgttt tggtctcatc atggaagcct actgcagagg      2400
     cagcacccac cacatgaagg tgctgatgaa gcagggggaa gcactgagca agcttaaggc      2460
     actgaatgac tttgtgaagg tgagttccca gaagaccacc aagccccaaa ccaaggagat      2520
     gatgcatatg tgcatgcgcc aggagaccta catggaggcc ctgtcccacc tgcagtctcc      2580
     actcgacccc agcaccctgc tggaggaagt ctgtgtggag cagtgcacct tcatggactc      2640
     caaaatgaag cccctgtgga tcatgtacag cagcgaggag gcgggcagtg ctggcaacgt      2700
     gggcatcatc tttaagaacg gggatgacct ccgccaggac atgctgactc tgcagatgat      2760
     ccagctcatg gacgtcctgt ggaagcagga gggcctggac ctgaggatga cgccctacgg      2820
     ctgcctcccc accggggacc gcacaggtct catcgaggtg gtcctccact cggacaccat      2880
     cgccaacatc cagctgaaca aaagcaacat ggcggccaca gctgccttca acaaggacgc      2940
     cctgctcaac tggctcaagt ccaagaaccc tggggaggcc ctggatcggg ccattgagga      3000
     attcaccctc tcctgtgctg gctactgtgt ggccacatat gttctgggca tcggtgaccg      3060
     gcacagcgac aacatcatga tcagagagag tgggcagctc ttccacattg attttggcca      3120
     ctttctgggg aacttcaaga ccaagtttgg aatcaaccga gagcgcgtcc ccttcattct      3180
     cacctacgac tttgtccacg tgatccagca ggggaagact aacaacagtg agaagtttga      3240
     aaggttccgc ggctactgtg aacgagccta taccatcctg cggcgccacg ggctgctttt      3300
     cctccatctc ttcgccctga tgcgggccgc aggtctgcct gagcttagct gctccaaaga      3360
     tatccagtat ctcaaggact ctctggcact ggggaagacg gaggaagagg cgctaaagca      3420
     cttccgggtg aagttcaacg aagctctccg agaaagctgg aaaaccaaag tcaactggct      3480
     ggcgcacaat gtgtccaagg ataaccgaca gtaggaggcg ccccctggtg gtcatacggc      3540
     ggttccctcc tggctttcag ccctagaggt aaaaggacag tcctggagac caggcatgtc      3600
     cagtggtcac caaagggacc ccagagcctg aactgtccct catggggaag aaccacacca      3660
     ctgcttcttg tttacactgg taatttattt atgactcgaa atgtttaagg aacagaatag      3720
     ccataaatgg aagtgcattt ctgtgcaggg gaggggtgat gtcctcatga tgtcatcccc      3780
     ggtcagcact gtaacagcac cttgaggatc gaacccctag tcttccaacc tgtgggtctt      3840
     ggcccagcaa ggacagttct tggggccttc ttcccaggct cccagcaggc tgcctggaac      3900
     aagcctggcg gtcacctggt gcctccatcc tcagctcacc tccggccacc gttgtgtggc      3960
     ctacccaacc aagcctccgg cagctcttga ggaagccagg agcttccctc tagactcagg      4020
     cacacttgct cggcactgct gaagcgacct cttgggtttg ggtacgggaa cgccctcacc      4080
     tctcatttgc gggtaagaac acgatatgta gactctgtcc cttaccccga tggctggggt      4140
     aagggacctg gcctccacta cagttagtgt attccaggcc ttgaagcact cagaccggtg      4200
     ccccatttag ctccgtgtgg tcacgaatca agacgaaggg ccagccagaa ttgaagtcct      4260
     cttcgaagtt cgtgtgaggg gcacacaagg cagctttatg gacggacagg actgatctct      4320
     tccagagctg aaatcgc                                                     4337
//


spacer
spacer