spacer

EBI Dbfetch

ID   AK149931; SV 1; linear; mRNA; HTC; MUS; 2803 BP.
XX
AC   AK149931;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus bone marrow macrophage cDNA, RIKEN full-length enriched
DE   library, clone:G530106G21 product:valosin containing protein, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2803
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 3a28530635b1c1384476064062380ddd.
DR   Ensembl-Gn; ENSMUSG00000028452; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030164; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Tissues were provided by David A. Hume ( Depts. of Biochemistry
CC   and Microbiology/Parasitology Institute for Molecular Bioscience
CC   University of Queensland Brisbane,Q 4072 Australia ) whose
CC   assistance we gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=G530106G21
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2803
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="G530106G21"
FT                   /cell_type="macrophage"
FT                   /tissue_type="bone marrow"
FT                   /db_xref="taxon:10090"
FT   CDS             223..2643
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="putative"
FT                   /note="valosin containing protein (MGD|MGI:99919
FT                   GB|BC049114, evidence: BLASTN, 100%, match=2802)"
FT                   /db_xref="GOA:Q01853"
FT                   /db_xref="InterPro:IPR003338"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR004201"
FT                   /db_xref="InterPro:IPR005938"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR015415"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029067"
FT                   /db_xref="MGI:MGI:99919"
FT                   /db_xref="PDB:1E32"
FT                   /db_xref="PDB:1R7R"
FT                   /db_xref="PDB:1S3S"
FT                   /db_xref="PDB:2PJH"
FT                   /db_xref="PDB:3CF0"
FT                   /db_xref="PDB:3CF1"
FT                   /db_xref="PDB:3CF2"
FT                   /db_xref="PDB:3CF3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q01853"
FT                   /protein_id="BAE29175.1"
FT                   /translation="MASGADSKGDDLSTAILKQKNRPNRLIVDEAINEDNSVVSLSQPK
FT                   MDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQP
FT                   CPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEF
FT                   KVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGCRKQLAQIKEMVEL
FT                   PLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGE
FT                   SESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAH
FT                   VIVMAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEILQIHTKNMKLADDVDLEQV
FT                   ANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQ
FT                   SNPSALRETVVEVPQVTWEDIGGLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFY
FT                   GPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFF
FT                   DELDSIAKARGGNIGDGGGAADRVINQILTEMDGMSTKKNVFIIGATNRPDIIDPAILR
FT                   PGRLDQLIYIPLPDEKSRVAILKANLRKSPVAKDVDLEFLAKMTNGFSGADLTEICQRA
FT                   CKLAIRESIESEIRRERERQTNPSAMEVEEDDPVPEIRRDHFEEAMRFARRSVSDNDIR
FT                   KYEMFAQTLQQSRGFGSFRFPSGNQGGAGPSQGSGGGTGGSVYTEDNDDDLYG"
XX
SQ   Sequence 2803 BP; 697 A; 653 C; 782 G; 671 T; 0 other;
     gagtcgctgc ccccctcgcg gattaggagc tagcgtctcc cgcccgcccg cctgccgccc        60
     cggtgcccct gggaggaagc gagagggagg ctgccagagg gtttgtcact gctgttgctc       120
     ctccgcctca gcgagtccag ccccggccta gtcggtcgcc tgcctttctc atagccgtta       180
     ccctcaggcc gccacagccg ccgaccggga gaggcgcgcg ccatggcctc tggagccgat       240
     tcaaaaggtg atgatttatc aacagccatt ctcaaacaga agaaccgacc caatcggtta       300
     attgttgatg aagccatcaa tgaagataac agcgtggtgt ccttgtccca gcccaagatg       360
     gatgaactgc agttgttccg aggtgacacg gtgttgctaa aaggaaagaa aagacgggaa       420
     gctgtatgca ttgttctttc tgatgacacg tgttctgatg agaagattcg aatgaataga       480
     gttgttcgga ataacctccg agttcgccta ggagatgtca tcagcatcca gccatgccct       540
     gatgtaaagt atggcaaacg tatccacgtt ctacccatcg atgacacagt ggaaggcatc       600
     actggcaatc tctttgaggt ataccttaag ccgtacttcc tggaagctta tcggcccatc       660
     cgtaaaggag atatttttct tgtccggggt gggatgcgtg ctgtggagtt caaagttgta       720
     gagacagatc ccagccctta ctgtattgtt gctccagaca cagtgatcca ctgtgagggg       780
     gagccaatca agcgagagga tgaggaggaa tccttgaatg aagtaggcta tgatgacatc       840
     ggtggttgca ggaagcagct agctcagata aaggagatgg tggagctgcc actgagacat       900
     cctgcgctct ttaaggcgat tggtgtaaag cctcctcggg gaatcttgtt gtatgggcct       960
     cctgggacag ggaagaccct gattgctcga gctgtggcaa atgaaactgg agccttcttc      1020
     tttctgatca atggtcctga aatcatgagc aaattggctg gtgagtctga gagcaacctt      1080
     cgtaaagcct ttgaggaagc tgaaaagaat gctcctgcta tcatcttcat cgatgagctt      1140
     gatgccattg cacccaaaag agagaaaact catggggaag tggagcgtcg catcgtgtct      1200
     cagttgttga ccctcatgga tggcctaaag cagagagcac atgtgatagt tatggcagca      1260
     accaatagac ccaacagcat tgacccagcc ctacggcgat ttggtcgctt tgacagagag      1320
     gtagatattg gaatacctga tgctacagga cgtttggaga ttcttcagat ccataccaag      1380
     aacatgaaac tggcagatga tgtggacttg gaacaggtag ccaatgagac tcatggtcat      1440
     gttggtgctg atttggcagc cctatgttca gaggctgctc tgcaggccat ccggaaaaaa      1500
     atggacctca ttgacctaga agatgagacc attgatgctg aggtcatgaa ttccctggca      1560
     gttactatgg atgacttccg gtgggctttg agtcaaagca acccatcagc acttcgggaa      1620
     actgtggtag aggtgccaca agtaacctgg gaagatattg gaggcctgga ggatgtcaaa      1680
     cgtgagcttc aggagttggt tcagtatcct gtggaacatc cagacaaatt cctcaaattt      1740
     ggcatgactc cctccaaagg cgttcttttc tatggacctc ctggctgtgg gaaaacctta      1800
     ctggctaaag ccattgctaa tgaatgccag gccaacttca tctccatcaa gggtcctgag      1860
     ctgcttacca tgtggtttgg ggaatctgag gccaatgtcc gggaaatttt tgacaaggca      1920
     cggcaagctg ccccctgtgt actcttcttt gatgagttag attcaattgc caaggctcga      1980
     ggtggtaata ttggagatgg tggtggagct gctgaccgag tcatcaatca gatcctgaca      2040
     gaaatggatg gcatgtctac aaaaaagaat gtgtttatca ttggagctac caacaggcct      2100
     gacatcattg atcctgctat cctaagacct ggccgtctag atcagctcat ttatatccca      2160
     cttcctgatg agaagtcccg tgttgccatc ctaaaagcca atctgcgaaa gtccccagtt      2220
     gccaaggatg tggatttgga gttcctggct aagatgacta atggcttttc tggagctgat      2280
     ttgacagaaa tttgccaacg ggcttgtaaa ctggccattc gtgaatctat tgagagtgag      2340
     attaggcgag aacgagagag gcagacaaat ccatcggcta tggaggtaga agaggacgat      2400
     ccagtgcctg agatccgcag agatcacttt gaggaagcca tgcgttttgc ccgacgttct      2460
     gtcagcgata atgacattcg gaagtatgaa atgttcgccc agacactgca gcagagtcga      2520
     ggttttggca gcttcagatt cccttcaggg aaccagggtg gagctggtcc cagccagggc      2580
     agtggaggtg gcacaggtgg cagtgtgtac acagaagaca atgacgatga cctgtatggc      2640
     taagtgatgt gccagcatgc agcgagctgg cctggctgga ccttgttccc tgggggaggg      2700
     ggcgcttgcc caagagggac caggggtgtg cccatggcct gttccattcc tcagtctgaa      2760
     cagttcagcc ccagtcagac tctggacagg ggtttcctgt tgc                        2803
//


spacer
spacer