spacer

EBI Dbfetch

ID   AK149576; SV 1; linear; mRNA; HTC; MUS; 904 BP.
XX
AC   AK149576;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus adult male liver tumor cDNA, RIKEN full-length enriched
DE   library, clone:C730042K13 product:apolipoprotein A-I, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-904
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 00e9c5e3865dcdd29d8ad08ffd73bdc9.
DR   Ensembl-Gn; ENSMUSG00000032083; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034588; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=C730042K13
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..904
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="C730042K13"
FT                   /cell_type="tumor"
FT                   /tissue_type="liver"
FT                   /db_xref="taxon:10090"
FT   CDS             49..843
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="apolipoprotein A-I (MGD|MGI:88049 GB|NM_009692,
FT                   evidence: BLASTN, 99%, match=902)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q00623"
FT                   /db_xref="InterPro:IPR000074"
FT                   /db_xref="MGI:MGI:88049"
FT                   /db_xref="PDB:2LEM"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q00623"
FT                   /protein_id="BAE28968.1"
FT                   /translation="MKAVVLAVALVFLTGSQAWHVWQQDEPQSQWDKVKDFANVYVDAV
FT                   KDSGRDYVSQFESSSLGQQLNLNLLENWDTLGSTVSQLQERLGPLTRDFWDNLEKETDW
FT                   VRQEMNKDLEEVKQKVQPYLDEFQKKWKEDVELYRQKVAPLGAELQESARQKLQELQGR
FT                   LSPVAEEFRDRMRTHVDSLRTQLAPHSEQMRESLAQRLAELKSNPTLNEYHTRAKTHLK
FT                   TLGEKARPALEDLRHSLMPMLETLKTQVQSVIDKASETLTAQ"
FT   regulatory      886..891
FT                   /note="putative"
FT                   /regulatory_class="polyA_signal_sequence"
FT   polyA_site      904
FT                   /note="putative"
XX
SQ   Sequence 904 BP; 231 A; 253 C; 265 G; 155 T; 0 other;
     gacccagact gtcggagagc tccggggagg tcacccacac ccttcaggat gaaagctgtg        60
     gtgctggccg tggctctggt cttcctgaca gggagccagg cttggcacgt atggcagcaa       120
     gatgaacccc agtcccaatg ggacaaagtg aaggatttcg ctaatgtgta tgtggatgcg       180
     gtcaaagaca gcggcagaga ctatgtgtcc cagtttgaat cctcctcctt gggccaacag       240
     ctgaacctga atctcctgga aaactgggac actctgggtt caaccgttag tcagctgcag       300
     gaacggctgg gcccattgac tcgggacttc tgggataacc tggagaaaga aacagattgg       360
     gtgagacagg agatgaacaa ggacctagag gaagtgaaac agaaggtgca gccctacctg       420
     gacgaattcc agaagaaatg gaaagaggat gtggagctct accgccagaa ggtggcgcct       480
     ctgggcgccg agctgcagga gagcgcgcgc cagaagctgc aggagctgca agggagactg       540
     tcccctgtgg ctgaggaatt tcgcgaccgc atgcgcacac acgtagactc tctgcgcaca       600
     cagctagcgc cccacagcga acagatgcgc gagagcctgg cccagcgcct ggctgagctc       660
     aagagcaacc ctaccttgaa cgagtaccac accagggcca aaacccacct gaagacactt       720
     ggcgagaaag ccagacctgc gctggaggac ctgcgccata gtctgatgcc catgctggag       780
     acgcttaaga cccaagtcca gagtgtgatc gacaaggcca gcgagactct gactgcccag       840
     tgaggtgccc gcttccactc cccacccccg cattggcttt cttacaataa acctttccaa       900
     aatg                                                                    904
//


spacer
spacer