spacer

EBI Dbfetch

ID   AK149471; SV 1; linear; mRNA; HTC; MUS; 1457 BP.
XX
AC   AK149471;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus adult male liver tumor cDNA, RIKEN full-length enriched
DE   library, clone:C730019N20 product:arginase 1, liver, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1457
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; f7dd0d0310db0553858174ee3cba525f.
DR   Ensembl-Gn; ENSMUSG00000019987; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020161; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=C730019N20
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1457
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="C730019N20"
FT                   /cell_type="tumor"
FT                   /tissue_type="liver"
FT                   /db_xref="taxon:10090"
FT   CDS             50..1057
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="arginase 1, liver (MGD|MGI:88070 GB|NM_007482,
FT                   evidence: BLASTN, 99%, match=1431)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q61176"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR014033"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="MGI:MGI:88070"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61176"
FT                   /protein_id="BAE28901.1"
FT                   /translation="MQQQQPLEPRESMSSKPKSLEIIGAPFSKGQPRGGVEKGPAALRK
FT                   AGLLEKLKETEYDVRDHGDLAFVDVPNDSSFQIVKNPRSVGKANEELAGVVAEVQKNGR
FT                   VSVVLGGDHSLAVGSITGHARVHPDLCVIWVDAHTDINTPLTTSSGNLHGQPVSFLLKE
FT                   LKGKFPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYIIKTLGIKYFSMTEVDKLGIGK
FT                   VMEETFSYLLGRKKRPIHLSFDVDGLDPAFTPATGTPVLGGLSYREGLYITEEIYKTGL
FT                   LSGLDIMEVNPTLGKTAEEVKSTVNTAVALTLACFGTQREGNHKPGTDYLKPPK"
FT   polyA_signal    1440..1445
FT                   /note="putative"
FT   polyA_site      1457
FT                   /note="putative"
XX
SQ   Sequence 1457 BP; 432 A; 323 C; 372 G; 330 T; 0 other;
     ggtcttttag ggttacggcc ggtggagagg agctggacag cccgagcaca tgcagcagca        60
     gcagccgctg gaacccagag agagcatgag ctccaagcca aagtccttag agattatcgg       120
     agcgcctttc tcaaaaggac agcctcgagg aggggtagag aaaggccctg cagcactgag       180
     gaaagctggt ctgctggaaa aacttaaaga aacagagtat gacgtgagag accacgggga       240
     cctggccttt gttgatgtcc ctaatgacag ctcctttcaa attgtgaaga acccacggtc       300
     tgtggggaaa gccaatgaag agctggctgg tgtggtggca gaggtccaga agaatggaag       360
     agtcagtgtg gtgctgggtg gagaccacag tctggcagtt ggaagcatca ctggccacgc       420
     cagggtccac cctgacctat gtgtcatttg ggtggatgct cacactgaca tcaacactcc       480
     cctgacaacc agctctggga atctgcatgg gcaacctgtg tcctttctcc tgaaggaact       540
     gaaaggaaag ttcccagatg taccaggatt ctcctgggtg actccctgca tatctgccaa       600
     agacatcgtg tacattggct tgcgagacgt agaccctggg gaacactata taataaaaac       660
     tctgggaatt aagtatttct ccatgactga agtagacaag ctggggattg gcaaggtgat       720
     ggaagagacc ttcagctacc tgctgggaag gaagaaaagg ccgattcacc tgagctttga       780
     tgtcgacggg ctggacccag cattcacccc ggcgaccggc accccggttc tgggaggcct       840
     atcttacaga gaaggtctct acatcacaga agaaatttac aagacagggc tcctttcagg       900
     actagatatc atggaagtga acccaactct tgggaagaca gcagaggagg tgaagagtac       960
     tgtgaacacg gcagtggctt taaccttggc ttgcttcgga actcaacggg agggtaacca      1020
     taagccaggg actgactacc ttaaaccacc taagtgactg tgaatgcgcc acatgaaaac      1080
     catctggggc atcacagcaa agcagacaga actaagcaaa cgccttctcc tcccaagggc      1140
     ttgttctttt agaaaaaaaa aaaatttttt ttccagtaag tatgtatccc agcagttcct      1200
     ttctggtatg aaattcagga tgtggaaatc aaaacagcta taaaactagg aaacatgtat      1260
     tccccatttt agcataagtt atccttaaga agtagtatcc aattaatttt caattaaaaa      1320
     atgcaccagc atttaaaata cacggtgatg ttaagtgtca attcacagtt ggaagcaaag      1380
     gtatccagag aggtagccta tatccacgct gttcaaaaga tgtataataa actctttata      1440
     ataaaattct gttgtct                                                     1457
//


spacer
spacer