spacer

EBI Dbfetch

ID   AK149289; SV 1; linear; mRNA; HTC; MUS; 1393 BP.
XX
AC   AK149289;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus adult retina cDNA, RIKEN full-length enriched library,
DE   clone:A930012N24 product:3-phosphoinositide dependent protein kinase-1,
DE   full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1393
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 69f9242a5fc13d3788ace1b81882c2c3.
DR   Ensembl-Gn; ENSMUSG00000024122; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102927; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115407; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115411; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=A930012N24
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1393
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="A930012N24"
FT                   /tissue_type="retina"
FT                   /db_xref="taxon:10090"
FT   CDS             93..>1393
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="3-phosphoinositide dependent protein kinase-1
FT                   (MGD|MGI:1338068 GB|AF079535, evidence: BLASTN, 99%,
FT                   match=1392)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q3UEW8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="MGI:MGI:1338068"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UEW8"
FT                   /protein_id="BAE28793.1"
FT                   /translation="MARTTSQLYDAVPIQSSVVLCSCPSPSMVRSQTEPGSSPGIPSGV
FT                   SRQGSTMDGTTAEARPSTNPLQQHPAQLPPQPRKKRPEDFKFGKILGEGSFSTVVLARE
FT                   LATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLS
FT                   YAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHI
FT                   QITDFGTAKVLSPESKQARANSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAG
FT                   LPPFRAGNEYLIFQKIIKLEYHFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLK
FT                   AHPFFETITWENLHQQTPPKLTAYLPAMSEDDEDCYGNYDNLLSQFGFMQVSSSSSSHS
FT                   LSTVETSLPQRSGSNIEQYIHDLDTNSFELDLQFS"
XX
SQ   Sequence 1393 BP; 371 A; 356 C; 333 G; 333 T; 0 other;
     tttgctgggg ctccgccgcg gggaggagga cgctgaggag gcgccgagca gcgcaacgct        60
     gcgggggagg cgcccgcgcc gacttggggc tcatggccag gaccaccagc cagctgtatg       120
     acgctgtgcc cattcagtcc agtgtggtgc tatgttcctg cccatcccca tcaatggtga       180
     ggtcccagac tgagcccggt tcgtcccctg gcattcctag tggtgttagc aggcagggat       240
     ccaccatgga tggcaccaca gctgaagccc gaccaagcac caaccccttg cagcagcacc       300
     ctgcccagct gccaccacag cctcgcaaga aacgccctga agacttcaag tttgggaaaa       360
     ttcttggcga gggctctttt tcaacagttg ttctggcccg agaactggcc acttccagag       420
     aatatgctat taaaattctg gagaaacgtc atattataaa agaaaacaaa gttccgtatg       480
     taactagaga gagagatgtg atgtcacgcc tggatcaccc cttctttgtg aaactttatt       540
     ttacatttca ggacgacgaa aagctgtatt ttggccttag ttatgccaaa aatggagagc       600
     tacttaaata catccgcaaa attggctcat ttgatgagac ctgtacccgg ttttacacgg       660
     ctgagattgt gtctgcttta gagtacttgc atggcaaggg catcattcac agagacctta       720
     aaccagaaaa cattttgtta aatgaagaca tgcacatcca gatcacagat tttggaacag       780
     caaaagtgtt atccccagag agcaaacaag ccagggccaa ctcatttgta ggaacagcac       840
     agtatgtttc tccagagctg ctcacagaga agtcggcgtg taaaagttca gacctttggg       900
     cccttggatg tataatctat cagctcgtgg caggactccc accattcaga gccgggaatg       960
     aatatcttat atttcagaag atcattaagc tggaatatca tttcccagaa aaattcttcc      1020
     ctaaggctag agatcttgtg gaaaaactct tggttttaga tgccacaaag cgtttaggct      1080
     gtgaagagat ggaagggtac gggcctctca aagctcatcc attctttgag accatcactt      1140
     gggagaattt gcaccagcag acacctccga agctcacagc ttacctacca gccatgtcag      1200
     aggatgatga agactgctat ggcaactacg acaatctcct gagccagttt ggcttcatgc      1260
     aggtgtcatc ctcctcctct tcccactccc tgtctacggt ggaaaccagc ctgccccaga      1320
     ggtcgggcag caacatagag cagtacatcc atgatttgga cactaactct tttgaactag      1380
     acttacagtt ttc                                                         1393
//


spacer
spacer