spacer

EBI Dbfetch

ID   AK148989; SV 1; linear; mRNA; HTC; MUS; 1554 BP.
XX
AC   AK148989;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus 2 days neonate sympathetic ganglion cDNA, RIKEN full-length
DE   enriched library, clone:7120471O12 product:ATPase, Na+/K+ transporting,
DE   alpha 1 polypeptide, full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1554
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   Ensembl-Gn; ENSMUSG00000033161; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000036493; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=7120471O12
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1554
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="2 days neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="7120471O12"
FT                   /tissue_type="sympathetic ganglion"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..1223
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /note="ATPase, Na+/K+ transporting, alpha 1 polypeptide
FT                   (MGD|MGI:88105 GB|NM_144900, evidence: BLASTN, 100%,
FT                   match=1553)"
FT                   /note="putative"
FT                   /note="start codon is not identified"
FT                   /db_xref="GOA:Q3UF49"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="MGI:MGI:88105"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UF49"
FT                   /protein_id="BAE28712.1"
FT                   /translation="GDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVNQVNPRDAKA
FT                   CVVHGSDLKDMTSEELDDILRYHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVND
FT                   SPALKKADIGVAMGIVGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTL
FT                   TSNIPEITPFLIFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEQAESDIMKRQPRNP
FT                   KTDKLVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPFHLLGIRETWDDRWVNDV
FT                   EDSYGQQWTYEQRKIVEFTCHTAFFVSIVVVQWADLVICKTRRNSVFQQGMKNKILIFG
FT                   LFEETALAAFLSYCPGMGAALRMYPLKPTWWFCAFPYSLLIFVYDEVRKLIIRRRPGGW
FT                   VEKETYY"
FT   polyA_signal    1532..1537
FT                   /note="putative"
FT   polyA_site      1554
FT                   /note="putative"
XX
SQ   Sequence 1554 BP; 372 A; 390 C; 425 G; 367 T; 0 other;
     taggagacca tccaatcaca gcgaaagcca ttgccaaggg ggtaggcatt atctcagaag        60
     gcaatgagac tgtggaagac attgctgccc gcctcaacat tccagtgaac caggtgaacc       120
     ccagagatgc caaggcctgt gtggtccacg gcagtgacct gaaggacatg acctccgagg       180
     agctggatga catcttgcgg taccacacag agatcgtctt tgccaggacc tctcctcagc       240
     agaagctcat cattgtggag ggctgccagc ggcagggcgc catcgtggcc gtcacagggg       300
     atggtgtcaa tgactctcca gctttgaaaa aggcagatat tggggttgcc atggggattg       360
     ttggctctga tgtgtccaag caagctgctg acatgatcct tctggatgac aactttgcct       420
     ccattgtgac tggagtagag gaaggtcgtc tgatttttga taacttgaag aaatccatcg       480
     cttacaccct aaccagtaac attccggaaa tcaccccctt cttgatattt attattgcaa       540
     acattccact gcccctgggg actgtgacca tcctctgcat tgacttgggc actgacatgg       600
     ttcctgccat ctccctggcc tacgagcaag ctgagagcga catcatgaag aggcagccca       660
     gaaaccccaa aacggacaaa cttgtgaacg agcgtctgat cagcatggcc tatggacaga       720
     tcggtatgat ccaggccctg ggaggcttct tcacttactt tgtgattctg gctgagaacg       780
     gtttcctgcc ctttcacctg ttgggcatcc gagagacctg ggatgaccgc tgggtcaacg       840
     atgtggagga cagctacggg cagcagtgga cctacgagca gaggaagatc gtggagttca       900
     cctgccatac agcgttcttt gtcagtattg tggtagtgca gtgggccgac ttggtcatct       960
     gcaagaccag aaggaattct gtcttccagc agggaatgaa gaacaagatc ttgatatttg      1020
     gcctctttga agagacagcc cttgctgctt tcttatccta ctgccccggg atgggggcag      1080
     cccttaggat gtatcccctc aaacctacat ggtggttctg tgccttcccc tactcccttc      1140
     tcatctttgt gtatgacgag gtgcggaagc tcattatcag gcggcgccct ggcggctggg      1200
     tggagaagga aacctactac tagcccactg ccctgcacgc cgtggaacat tgtgccacac      1260
     actgcaccca cccctacccc ctctttgtgt acttcaagtc ttggagctcg gaactctacc      1320
     ctggtaggaa agcaccaaag catgtgggga tgcagacgtc ctggaatgaa gcatgtagct      1380
     gtaacggggg gcggggcggg ggggagggct gcctgagaaa caccgtgtac ggggacgaca      1440
     gcgggcaagg tttatacgtg cctttttgtt tttgtaaaaa aggaaaacct ggaaagactg      1500
     aaagattacg ttttatatct ggatttttac aaataaagat ggctattata acgg            1554
//


spacer
spacer