Dbfetch

ID   AK148881; SV 1; linear; mRNA; HTC; MUS; 3043 BP.
XX
AC   AK148881;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus 2 days neonate sympathetic ganglion cDNA, RIKEN full-length
DE   enriched library, clone:7120459A07 product:Voltage-gated sodium channel
DE   (SCN3A) (Fragment) homolog [Homo sapiens], full insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3043
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 9f7daecd0ca3f46d5194e0bce34e425e.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=7120459A07
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3043
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="2 days neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="7120459A07"
FT                   /tissue_type="sympathetic ganglion"
FT                   /db_xref="taxon:10090"
FT   CDS             277..882
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="Voltage-gated sodium channel (SCN3A) (Fragment)
FT                   homolog [Homo sapiens] (UniProt|Q9GZM4, evidence: FASTY,
FT                   98.6%ID, 60.3%length, match=219)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q3UF73"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR027359"
FT                   /db_xref="MGI:MGI:98249"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UF73"
FT                   /protein_id="BAE28688.1"
FT                   /translation="MAQALLVPPGPESFRLFTRESLAAIEKRAAEEKAKKPKKEQDIDD
FT                   ENKPKPNSDLEAGKNLPFIYGDIPPEMVSEPLEDLDPYYVSKKTFVVLNKGKAIFRFSA
FT                   TSALYILTPLNPVRKIAIKILVHSLFSMLIMCTILTNCVFMTLSNPPDWTKNVEYTFTG
FT                   IYTFESLIKILARGFCLEDFTFLRDPWNWLDFSVIVMA"
XX
SQ   Sequence 3043 BP; 872 A; 627 C; 711 G; 833 T; 0 other;
     gatcatagag tgaatctcag aacaggaagc ggaggcataa gcagaaagga ttctggaaag        60
     gtctctttgt tttcatatcc acagagaaag caagaaaaaa aaattgaatg taatttgcaa       120
     atccctgtgg cccaaatctg aagaactact gggggtggca cgttccattc taaccatctt       180
     ggatgctgtc ctttgttgag ctgtgattcc taaggctctc catcaggcaa ttcttatgca       240
     agaagctaaa cgtaattaaa tgtgcaggat gaaaagatgg cccaggcact gctggtaccc       300
     ccgggacctg agagcttccg ccttttcact cgagaatctc ttgctgctat cgaaaagcgt       360
     gctgcagaag agaaagccaa gaaacccaag aaagaacaag acattgacga tgagaacaag       420
     ccaaagccaa acagtgactt ggaagctggg aagaaccttc catttatcta tggagacatt       480
     cctccagaga tggtgtcgga gcctctggag gacctggacc cctactacgt cagtaagaaa       540
     acttttgtag tgttgaataa agggaaggca atttttcgat tcagtgccac ctccgccttg       600
     tatattttaa ctccactaaa ccccgttagg aaaattgcta ttaagatttt ggtacactct       660
     ttattcagca tgcttatcat gtgcactatt ttgaccaact gtgtatttat gacattgagc       720
     aatcctcctg actggacgaa gaatgtagag tacacattca ctgggatcta tacctttgag       780
     tcacttataa agatcttggc cagaggattc tgcttagaag atttcacatt tcttcgtgac       840
     ccatggaact ggctggattt cagtgtcatc gtgatggcgt gagtaaaaat ttttttttaa       900
     agtctggaaa attcaaagga ataaaaaaat ttactgtata aatcaattta agacatgttt       960
     tgaatacaga gctttcttgt taatcaggtc aactctatgc catacacagt atgataatat      1020
     gaattagact attaaaagat agatatatct agcaaatcag caacatatgg aattatttta      1080
     ttgtccctta gtctttgagc aataaatgga gttactttat agtccaccat ctttttcttc      1140
     atcaaaatca agttacttat taactacaat ttaatagaaa ctatggtgcc atgatacatt      1200
     ttgcaaacaa tcactgcgta aatgaaaatt acattgaaat acagctctat tttttttttc      1260
     ccttaaaggc aactttcatc ctttggcatc ctgagcttta aatcaatttg tttatgtatc      1320
     tcaaggggct tttgatgcca atccagcatt agtcacttaa aatgaacttt gccaaaacta      1380
     tcagtaactc tgatttaatc ctacaggtat gtaacagaat ttgtaagcct aggcaatgtt      1440
     tcagctcttc gaactttcag agtcttgcga gctctgaaaa ctatttctgt aattccaggt      1500
     aagaagaaaa cggtgtaagg tggtaggccc ttatatctcc aacttttctt gtgtgttatt      1560
     gtgtttgtgt gtgaactccc tattacagat atgtgacaga gtttgtggac ctgggcaatg      1620
     tctcagcgct gagaacgttc agagttctcc gagcattgaa aacaatatca gtcattccag      1680
     gtttaaagac catcgtgggg gccctgatcc agtcggtgaa gaagctgtct gacgtcatga      1740
     tactcactgt gttctgtctg agcgtctttg ctctcatcgg gctgcagctc ttcatgggca      1800
     acctgaggaa taaatgcttg cagtggcctc caagcgattc tgcttttgag atcaacacta      1860
     cttcctactt caatggcaca atggactcaa atgggacatt tgttaatgta acaatgagca      1920
     cattcaactg gaaggactat atcgcagatg acagccactt ttatgttttg gatggacaaa      1980
     aagatccttt actttgtgga aatgggtccg atgcaggaca atgtccagaa gggtacatct      2040
     gtgtgaaggc tggacgaaac cccaactacg gttacacgag ctttgacaca tttagctggg      2100
     ccttcttatc gctgtttcga ctcatgactc aagactactg ggagaacctt taccagttga      2160
     cattacgtgc agctgggaaa acctacatga tctttttcgt cctggtaatt ttcttgggct      2220
     cattttattt ggtgaacttg atcctggctg tggtggccat ggcctatgag gaacaaaatc      2280
     aggccacact ggaggaggct gagcagaaag aggcggagtt tcagcagatg ttggagcagt      2340
     tgaaaaagca gcaagaggag gctcaggcgg tggcagctgc ctcagcagcg tccagagact      2400
     tcagtgggat aggagggtta ggagaacttc tggagagttc ttcagaagct tccaagttga      2460
     gctccaagag tgccaaggag tggaggaatc ggaggaagaa gaggagacag agggagcact      2520
     tggagggaaa ccacagaccc gaaggagaca ggtttcccaa gtcggaatca gaagacagcg      2580
     tcaagcgaag gagtttcctg ttctccctgg atgggaaccc gctgagcggc gacaagaagc      2640
     tgtgctctcc ccatcagtct ctcttgagta tccgtggctc cctgttttcc ccaagacgca      2700
     atagcaaaac gagcattttc agcttcagag gtcgggcgaa ggacgtgggg tctgagaatg      2760
     actttgcgga tgatgaacac agcacctttg aagatagcga gagcaggaga gactcactgt      2820
     ttgtgccgca cagacctgga gagcgacgca acagtaacgt tagtcaggcc agtatgtcat      2880
     ccaggatggt gccagggctt ccagccaatg ggaagatgca cagcactgtg gattgcaatg      2940
     gtgtggtttc cttggtgggt ggaccctcag ctcttacgtc acctactgga cagcttccgc      3000
     cagaggtgat aatacataaa ccagctacta gtgacacttt act                        3043
//