spacer

EBI Dbfetch

ID   AK148764; SV 1; linear; mRNA; HTC; MUS; 1503 BP.
XX
AC   AK148764;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus 2 days neonate sympathetic ganglion cDNA, RIKEN full-length
DE   enriched library, clone:7120443F14 product:argininosuccinate lyase, full
DE   insert sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1503
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; 2adf627bd470bcdbc2945795bbfd591a.
DR   Ensembl-Gn; ENSMUSG00000025533; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000159619; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000160129; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000161094; mus_musculus.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=7120443F14
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1503
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="2 days neonate"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="7120443F14"
FT                   /tissue_type="sympathetic ganglion"
FT                   /db_xref="taxon:10090"
FT   CDS             66..1460
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="argininosuccinate lyase (MGD|MGI:88084 GB|NM_133768,
FT                   evidence: BLASTN, 100%, match=1500)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q91YI0"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="MGI:MGI:88084"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q91YI0"
FT                   /protein_id="BAE28659.1"
FT                   /translation="MASESGKLWGGRFVGAVDPIMEKFNSSISYDRHLWNVDVQGSKAY
FT                   SRGLEKAGLLTKAEMQQILQGLDKVAEEWAQGTFKLHPNDEDIHTANERRLKELIGEAA
FT                   GKLHTGRSRNDQVVTDLRLWMRQTCSKLSALLRVLIGTMVDRAEAERDVLFPGYTHLQR
FT                   AQPIRWSHWILSHAVALTRDSERLLEVQKRINVLPLGSGAIAGNPLGVDRELLRAELNF
FT                   GAITLNSMDATSERDFVAEFLFWASLCMTHLSRMAEDLILYGTKEFSFVQLSDAYSTGS
FT                   SLMPQKKNPDSLELIRSKAGRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMI
FT                   AVLQVATGVISTLQIHRENMKQALSPDMLATDLAYYLVRKGMPFRQAHEASGKAVFMAE
FT                   TKGVALNLLSLQELQTISPLFSGDVSHVWDYSHSVEQYSALGGTAKSSVEWQIRQVRAL
FT                   LQAQEP"
FT   polyA_signal    1487..1492
FT                   /note="putative"
FT   polyA_site      1503
FT                   /note="putative"
XX
SQ   Sequence 1503 BP; 372 A; 405 C; 446 G; 280 T; 0 other;
     gaaagccagg agagaccaga agattcgtaa gacagaagct ccaggaggag gaggaaccgc        60
     ccaacatggc atcagagagc gggaagctat ggggtggccg gtttgtgggt gctgtcgacc       120
     ccatcatgga gaagttcaac tcatctatct cctatgaccg gcatctgtgg aatgtggatg       180
     tgcaggggag caaggcctac agcaggggcc tggagaaggc ggggcttctc accaaagccg       240
     agatgcagca gatactgcaa gggttggaca aggttgctga agagtgggcc caaggcacct       300
     tcaaattaca tcctaatgat gaagacatcc acacagccaa cgagcggcgc ctgaaggaac       360
     tcatcggtga agctgcaggg aagctacaca caggacgaag tcgcaacgac caggtggtca       420
     cggacctcag gctgtggatg aggcagacct gctcaaaact ctccgccctc ctccgggtgc       480
     tcattggaac catggtcgac cgggcagagg cggaacgtga tgtcctcttc ccagggtaca       540
     cacacttgca gagagctcag cccattcgct ggagccactg gatcctgagc cacgctgttg       600
     cgctgacacg agattcagag agactcttgg aggtgcagaa gcggatcaat gtcttgccac       660
     tggggagtgg ggccattgca ggcaaccctc tgggtgtgga ccgggagcta ctccgtgcag       720
     aactgaactt tggggccatc actctcaaca gcatggatgc caccagtgag agagactttg       780
     tggctgagtt cctgttttgg gcttctctgt gtatgaccca cctcagcagg atggcagagg       840
     acctaattct ctatggtacc aaggaattca gctttgtgca actctcagat gcctacagca       900
     ccggaagcag cttgatgccc cagaagaaaa acccagacag cctggagctg atccggagca       960
     aggcgggccg agtgtttgga cggtgtgccg gactcctgat gaccctcaag ggacttccaa      1020
     gcacctacaa caaggactta caggaagaca aggaggctgt gtttgaagtg tctgacacca      1080
     tgatagctgt cctccaagtg gccactggag tcatctctac attgcagatt catcgtgaga      1140
     acatgaaaca ggcgctcagc cctgacatgc tggccacgga cctcgcctac tacctggtcc      1200
     gcaaagggat gccattccgc caggcccacg aggcctcagg gaaagctgtg ttcatggcag      1260
     agactaaagg agtggctctc aacctgctgt cgctacagga gctgcagacc atcagtcccc      1320
     tgttctcagg tgatgtgagt cacgtgtggg actacagtca cagcgtggaa cagtacagtg      1380
     ccttgggtgg cacagcgaaa tccagtgtcg aatggcagat caggcaggtg cgggccctac      1440
     tgcaagccca ggagccctag atcccgccca cccaaagctg ctccccaata aagtggagcc      1500
     ccg                                                                    1503
//


spacer
spacer