Dbfetch

ID   AK148295; SV 1; linear; mRNA; HTC; MUS; 3487 BP.
XX
AC   AK148295;
XX
DT   06-SEP-2005 (Rel. 85, Created)
DT   07-OCT-2010 (Rel. 106, Last updated, Version 11)
XX
DE   Mus musculus B16 F10Y cells cDNA, RIKEN full-length enriched library,
DE   clone:G370082F15 product:Adiponectin receptor protein 2, full insert
DE   sequence.
XX
KW   CAP trapper; HTC; HTC_FLI.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3487
RA   Arakawa T., Carninci P., Fukuda S., Hashizume W., Hayashida K., Hori F.,
RA   Iida J., Imamura K., Imotani K., Itoh M., Kanagawa S., Kawai J., Kojima M.,
RA   Konno H., Murata M., Nakamura M., Ninomiya N., Nishiyori H., Nomura K.,
RA   Ohno M., Sakazume N., Sano H., Sasaki D., Shibata K., Shiraki T.,
RA   Tagami M., Tagami Y., Waki K., Watahiki A., Muramatsu M., Hayashizaki Y.;
RT   ;
RL   Submitted (30-MAR-2004) to the INSDC.
RL   Contact:Yoshihide Hayashizaki The Institute of Physical and Chemical
RL   Research (RIKEN), Omics Science Center, RIKEN Yokohama Institute; 1-7-22
RL   Suehiro-cho, Tsurumi-ku, Yokohama, Kanagawa 230-0045, Japan URL   
RL   :http://www.osc.riken.jp/
XX
RN   [2]
RX   PUBMED; 16141072.
RG   The FANTOM Consortium, Riken Genome Exploration Research Group and Genome
RG   Science Group (Genome Network Project Core Group)
RA   ;
RT   "The Transcriptional Landscape of the Mammalian Genome";
RL   Science, e1252229 309(5740):1559-1563(2005).
XX
RN   [3]
RX   DOI; 10.1126/science.1112009.
RX   PUBMED; 16141073.
RG   RIKEN Genome Exploration Research Group and Genome Science Group (Genome
RG   Network Project Core Group) and the FANTOM Consortium
RA   ;
RT   "Antisense Transcription in the Mammalian Transcriptome";
RL   Science, e1252229 309(5740):1564-1566(2005).
XX
RN   [4]
RX   PUBMED; 12466851.
RG   The FANTOM Consortium and the RIKEN Genome Exploration Research Group Phase
RG   I and II Team
RA   ;
RT   "Analysis of the mouse transcriptome based on functional annotation of
RT   60,770 full-length cDNAs";
RL   Nature 420(6915):563-573(2002).
XX
RN   [5]
RX   PUBMED; 11217851.
RG   The RIKEN Genome Exploration Research Group Phase II Team and the FANTOM
RG   Consortium
RA   ;
RT   "Functional annotation of a full-length mouse cDNA collection";
RL   Nature 409(6821):685-690(2001).
XX
RN   [6]
RX   DOI; 10.1016/S0076-6879(99)03004-9.
RX   PUBMED; 10349636.
RA   Carninci P., Hayashizaki Y.;
RT   "High-efficiency full-length cDNA cloning";
RL   Meth. Enzymol. 303:19-44(1999).
XX
RN   [7]
RX   DOI; 10.1101/gr.145100.
RX   PUBMED; 11042159.
RA   Carninci P., Shibata Y., Hayatsu N., Sugahara Y., Shibata K., Itoh M.,
RA   Konno H., Okazaki Y., Muramatsu M., Hayashizaki Y.;
RT   "Normalization and subtraction of cap-trapper-selected cDNAs to prepare
RT   full-length cDNA libraries for rapid discovery of new genes";
RL   Genome Res. 10(10):1617-1630(2000).
XX
RN   [8]
RX   DOI; 10.1101/gr.152600.
RX   PUBMED; 11076861.
RA   Shibata K., Itoh M., Aizawa K., Nagaoka S., Sasaki N., Carninci P.,
RA   Konno H., Akiyama J., Nishi K., Kitsunai T., Tashiro H., Itoh M., Sumi N.,
RA   Ishii Y., Nakamura S., Hazama M., Nishine T., Harada A., Yamamoto R.,
RA   Matsumoto H., Sakaguchi S., Ikegami T., Kashiwagi K., Fujiwake S.,
RA   Inoue K., Togawa Y., Izawa M., Ohara E., Watahiki M., Yoneda Y.,
RA   Ishikawa T., Ozawa K., Tanaka T., Matsuura S., Kawai J., Okazaki Y.,
RA   Muramatsu M., Inoue Y., Kira A., Hayashizaki Y.;
RT   "RIKEN integrated sequence analysis (RISA) system--384-format sequencing
RT   pipeline with 384 multicapillary sequencer";
RL   Genome Res. 10(11):1757-1771(2000).
XX
DR   MD5; e48603796d69437f21af84cd87aa70b8.
DR   Ensembl-Gn; ENSMUSG00000030168; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031193; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0031162; mus_musculus_aj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031173; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030536; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031631; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030280; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0030856; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0031012; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0030964; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0031091; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030998; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031660; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029995; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0030363; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000032272; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000169744; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0079706; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0079769; mus_musculus_aj.
DR   Ensembl-Tr; MGP_BALBcJ_T0079713; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0077585; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0080186; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0079926; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0079293; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0079449; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0079332; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0079485; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0079340; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0080438; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0079356; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0078445; mus_musculus_wsbeij.
XX
CC   cDNA library was prepared and sequenced in Mouse Genome
CC   Encyclopedia Project of Genome Exploration Research Group in Riken
CC   Genomic Sciences Center and Genome Science Laboratory in RIKEN.
CC   Division of Experimental Animal Research in Riken contributed to
CC   prepare mouse tissues.
CC   Cells were provided by Drs. William J Pavan and Stacie Loftus and
CC   Denise Larson (Division of Intramural Research Genetic Disease
CC   Research Branch National Human Genome Reseach Institute National
CC   Institutes of Health (NIH) Building:  49, Room 4A82 49 Convent
CC   Drive MSC 4472 Bethesda,Maryland U.S.A) whose assistance we
CC   gratefully acknowledge.
CC   Please visit our web site for further details.
CC   URL:http://www.osc.riken.jp/
CC   URL:http://fantom.gsc.riken.jp/
CC   clone information is available at:
CC   http://fantom.gsc.riken.jp/3/db/annotate/
CC   main.cgi?masterid=G370082F15
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3487
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="RIKEN full-length enriched mouse cDNA library"
FT                   /clone="G370082F15"
FT                   /cell_type="B16 F10Y cells"
FT                   /db_xref="taxon:10090"
FT   CDS             295..1455
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /note="Adiponectin receptor protein 2 (UniProt|Q8BQS5,
FT                   evidence: FASTY, 100%ID, 100%length, match=1158)"
FT                   /note="putative"
FT                   /db_xref="GOA:Q53YY3"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="MGI:MGI:93830"
FT                   /db_xref="UniProtKB/TrEMBL:Q53YY3"
FT                   /protein_id="BAE28463.1"
FT                   /translation="MNEPAKHRLGCTRTPEPDIRLRKGHQLDDTRGSNNDNYQGDLEPS
FT                   LETPVCSSYYENSPEEPECHDDNSQEDEGFMGMSPLLQAHHAMERMEEFVCKVWEGRWR
FT                   VIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGCVFFLCLG
FT                   IFYMFRPNISFVAPLQEKVVFGLFFLGAILCLSFSWLFHTVYCHSEGVSRLFSKLDYSG
FT                   IALLIMGSFVPWLYYSFYCNPQPCFIYLIVICVLGIAAIIVSQWDMFATPQYRGVRAGV
FT                   FVGLGLSGIIPTLHYVISEGFLKAATIGQIGWLMLMASLYITGAALYAARIPERFFPGK
FT                   CDIWFHSHQLFHIFVVAGAFVHFHGVSNLQEFRFMIGGGCTEEDAL"
XX
SQ   Sequence 3487 BP; 821 A; 836 C; 926 G; 904 T; 0 other;
     gagtcccgac gcggtaccgc ggtggcggcg gcggcggtgg cggctccagc gagcggcccc        60
     ctccctccgc gccccccctc tccctccccg aggcgctgct tcccgaggcg cccgagccgc       120
     gcggtgagac ggccgctaac tcgggcgaag ggctgtggct cgagcgcggc ttcccgggct       180
     cagcagattg cccgggtcgg aaggagggtc aacttaccat cccttaaaaa tccattctcc       240
     caagaagaag ggacagaaag aaagaccact ttgtaagaaa ggctttggta tcccatgaac       300
     gagccagcca aacaccgatt ggggtgcacc aggactccag agccagatat acggctcaga       360
     aaagggcacc aacttgatga tacaagggga agtaataatg acaactacca aggagatttg       420
     gagcccagct tagagacacc tgtttgttct tcctattatg aaaatagccc ggaggagccc       480
     gagtgtcatg atgacaattc ccaggaagat gaagggttta tgggcatgtc cccgctccta       540
     caggcccatc atgctatgga acgaatggaa gagtttgttt gtaaggtgtg ggaaggccga       600
     tggcgagtga tccctcacga tgtgctaccg gattggctta aggataatga cttccttctc       660
     catggacacc ggcctcctat gccttccttt cgggcctgtt ttaagagcat ttttagaata       720
     cacacagaga cgggcaacat ttggacacat ctcctaggtt gtgtattctt cctgtgcctg       780
     gggatctttt atatgtttcg cccaaatata tcttttgtgg cccctctgca agagaaagtg       840
     gtctttggct tgttcttctt gggagccatt ctctgccttt ccttttcatg gctcttccac       900
     acggtgtact gccactcaga aggggtctcc cgactcttct ctaaattgga ttactctggt       960
     attgctcttc tgatcatggg aagttttgtt ccttggcttt attattcttt ctactgtaac      1020
     ccacaacctt gcttcatcta cctgattgtc atctgtgtgc tgggcattgc agccattatc      1080
     gtctctcagt gggacatgtt tgccacccct cagtatcggg gggtcagagc aggagtgttc      1140
     gtgggcttag gcctgagtgg aatcatccct accttgcatt atgtcatctc agaagggttc      1200
     ctgaaggctg ccaccatagg gcagataggc tggctaatgc ttatggctag cctctatatc      1260
     accggagctg ccctctatgc ggcccgtatc cctgagcgct tctttcctgg caaatgtgac      1320
     atctggtttc actctcatca gctcttccac atctttgtgg ttgctggtgc ctttgttcac      1380
     ttccacggag tctcaaacct gcaggaattt cgtttcatga ttggcggggg ctgcactgaa      1440
     gaggatgcac tgtgatactc tccaggaacc agggactctg accctgagcc aggcctgcag      1500
     gtcctgcagg ccttcttact ggctgtcggt gccagtgcca gagaagcccc aaaacttgga      1560
     cagcctcatg ggccttgtgt tggcccaagg gctccatggg gtacaagact aagaagagaa      1620
     aaacaaaaat aaatcatacc tcaaaggatg gaatgcatcg attaggagag aaggagaaat      1680
     ggctcatccc ctggcttcct cttgggatct accgattgaa agcaactctg caagaccctc      1740
     gcctgacagg ctggcttctg atgtgatcgt atttatttgt agaagatggg gaaacagttt      1800
     agttggtggt ctttcttctc ccttccttgc tccttgcagc agtaacatgt atgagtacca      1860
     tgcaccaact gatcgtgcca ttggagctcc ttaaacagta atcacaacca agttagggga      1920
     acatttgtat ccaataaagg ggtgggagtg cggttttagg cactcctttg ggagaacaaa      1980
     gaaattaatg taaataagat ttctaattta ctgtttaaat aagaattata taaacattta      2040
     agacataggg gcagggaggg agggagactt tttttaaaaa gaatgaaaca tgcaagtacc      2100
     acacactgtt tcaattttgc acaagtgatg ggaggaggat ggagtggtag ccccagaatg      2160
     cacgatgtct tggtgcacca aggtgccttc cctaggccga taacacttgg accctgctgg      2220
     ggcagagtgg acagccccag ccccaggaac ttcctggcca ctctcaagac tgagagcctt      2280
     tgggcattca gagggggagg gatgtggaag tcgtgtgtgc ttttcaatgg aagcagcaca      2340
     ggttgtcata gtggctctag agaaagtgtc atttgggaga ctgttatgta ggctagtgat      2400
     gacccttttg aagagtgaag ccacctggtt ctactgtaga tgtagtagag acttgatgaa      2460
     ggggaggagg acctgggggc atcagcatag gaatggtctg cttctccctg gtgtctcgtt      2520
     tgaccaggtg gtagttctta tctgaataga ggtatggcca ttttccagac cctctctgtg      2580
     gagctctgag ccattctgca aattttgctc tattgagaat cactgcccta actgtccttc      2640
     ctcctggaaa tcaaaaactg cccccccccc ccccccagca tcaaagctcc ttcgtggagc      2700
     cggccactag tgagattctg atgagcatgg gtcccacctg aagtcatgca ggcaggtgtg      2760
     gaggaccatc ccttggacta ggaatggtgg cgcttttctc tggtgcaggc ttggcaggct      2820
     tggcatgaca acagattctt ctcccgttga acaagaaagt cagtaatacc tactgtggag      2880
     ttgttagcac gcactgaatg ccatttgcaa gacctgtgct acagagttga aaaggaagtg      2940
     gactgttatt accaggtagt cggatagaat taaacccaca attttgaatt gctgctagaa      3000
     gttacaaata atttctttgt cctagggcct tcttgttatg ggttttagag agtggcagtg      3060
     agttgggtct tggctcctaa gtgagaaacc aagcacttga gtctcttaga ctctaggcct      3120
     cactccttgg ggctggtggg tattgcagtg taacatgggc ctcgggcatc ccaaaagggg      3180
     tgctgggcag tatgaggagg tcctgttttt acagtagtgt tttcttggtc gtcgttgtcc      3240
     ttcctctacc ttcagatcgc cacccagctg cagctgggac ccaggaagga gtccattgaa      3300
     aacctgggaa gaacttcaga gtattgggtt gtggataagg tcactgccct aggtaggccc      3360
     aacaggaagc tctgggtgaa cagcattgtg ccagacaact aagaacagtg ttaattcctc      3420
     aagaagcagt tcatcaagac agtgtccatc cggaaggaag ctcacctagg cttgtggtag      3480
     caacagc                                                                3487
//